Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 150168..150696 Replicon plasmid unnamed1
Accession NZ_CP118964
Organism Acinetobacter lwoffii strain DSM 2403

Toxin (Protein)


Gene name relE Uniprot ID N8PZF5
Locus tag PYW33_RS16010 Protein ID WP_004647759.1
Coordinates 150168..150461 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID N9NWT9
Locus tag PYW33_RS16015 Protein ID WP_000246755.1
Coordinates 150451..150696 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYW33_RS15980 145983..146516 - 534 WP_004647763.1 SMI1/KNR4 family protein -
PYW33_RS15985 146791..147723 - 933 WP_000743272.1 IS5-like element IS17 family transposase -
PYW33_RS15990 147815..148147 + 333 WP_265588134.1 SMI1/KNR4 family protein -
PYW33_RS15995 148269..148886 + 618 WP_004647761.1 hypothetical protein -
PYW33_RS16000 148999..149538 - 540 WP_252509242.1 IS630 family transposase -
PYW33_RS16005 149555..150010 - 456 WP_004647755.1 helix-turn-helix domain-containing protein -
PYW33_RS16010 150168..150461 - 294 WP_004647759.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PYW33_RS16015 150451..150696 - 246 WP_000246755.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PYW33_RS16020 150838..151728 - 891 WP_035334907.1 LysR family transcriptional regulator -
PYW33_RS16025 151878..152471 + 594 WP_004647752.1 NAD(P)H-dependent oxidoreductase -
PYW33_RS16030 152481..152795 + 315 WP_004647751.1 putative quinol monooxygenase -
PYW33_RS16035 152906..153196 - 291 WP_004647750.1 putative addiction module antidote protein -
PYW33_RS16040 153198..153494 - 297 WP_004647749.1 type II toxin-antitoxin system RelE/ParE family toxin -
PYW33_RS16045 153587..154564 - 978 WP_016807245.1 helix-turn-helix domain-containing protein -
PYW33_RS16050 154697..155581 + 885 WP_023278701.1 MBL fold metallo-hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..221373 221373
- flank IS/Tn - - 146791..147660 869


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-72)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11264.47 Da        Isoelectric Point: 10.4753

>T273670 WP_004647759.1 NZ_CP118964:c150461-150168 [Acinetobacter lwoffii]
MTYKLLRHKDFTAEWEKLPVAIRDQFKKKLAKAIEQPHIPKNMLRGDLAGCYKIKLLKAGVRLVYQVKDDQVVILLITVG
KRADSIVYDEAKKRIKD

Download         Length: 294 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9249.64 Da        Isoelectric Point: 4.3142

>AT273670 WP_000246755.1 NZ_CP118964:c150696-150451 [Acinetobacter lwoffii]
MATVNFRIDEALKEKSYSILKEQGIAPTDFFTSILEYVATTGKLPVKKALLSEEDEELLALVRKRINDPKEMFEEVTLDD
L

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB N8PZF5

Antitoxin

Source ID Structure
AlphaFold DB A0A6A1RJ80

References