Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 488541..489177 | Replicon | chromosome |
Accession | NZ_CP118963 | ||
Organism | Acinetobacter lwoffii strain DSM 2403 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | N8Q3V1 |
Locus tag | PYW33_RS02215 | Protein ID | WP_004645066.1 |
Coordinates | 488791..489177 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | N8Q7K6 |
Locus tag | PYW33_RS02210 | Protein ID | WP_004645065.1 |
Coordinates | 488541..488798 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYW33_RS02190 | 484022..485029 | + | 1008 | WP_004281489.1 | DNA-directed RNA polymerase subunit alpha | - |
PYW33_RS02195 | 485048..485413 | + | 366 | WP_004281488.1 | 50S ribosomal protein L17 | - |
PYW33_RS02200 | 485634..487124 | + | 1491 | WP_004645062.1 | NAD(P)/FAD-dependent oxidoreductase | - |
PYW33_RS02205 | 487185..488357 | - | 1173 | WP_004645063.1 | acyl-CoA dehydrogenase family protein | - |
PYW33_RS02210 | 488541..488798 | + | 258 | WP_004645065.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
PYW33_RS02215 | 488791..489177 | + | 387 | WP_004645066.1 | hypothetical protein | Toxin |
PYW33_RS02220 | 489713..490753 | + | 1041 | WP_004645068.1 | hypothetical protein | - |
PYW33_RS02225 | 490821..491393 | + | 573 | WP_004281478.1 | rhombosortase | - |
PYW33_RS02230 | 491591..493873 | + | 2283 | WP_004645069.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 15313.44 Da Isoelectric Point: 10.1100
>T273668 WP_004645066.1 NZ_CP118963:488791-489177 [Acinetobacter lwoffii]
MDNRCFKLKRSLCALAFQLFIFALLMYLLYQLLPIAIWAVCVVIGLVIYQLFYRKTPQIEQFEYLDGREWSLTTKARPTR
RVFISHVIDHQAYIVVYFQHAKARPLLIWCDQLPFKQWKSLKVLTKLV
MDNRCFKLKRSLCALAFQLFIFALLMYLLYQLLPIAIWAVCVVIGLVIYQLFYRKTPQIEQFEYLDGREWSLTTKARPTR
RVFISHVIDHQAYIVVYFQHAKARPLLIWCDQLPFKQWKSLKVLTKLV
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|