Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2770897..2771468 | Replicon | chromosome |
Accession | NZ_CP118962 | ||
Organism | Enterococcus faecalis strain DSM 20478 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | R3GRA7 |
Locus tag | PYW42_RS13660 | Protein ID | WP_002360937.1 |
Coordinates | 2770897..2771238 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S4CGQ1 |
Locus tag | PYW42_RS13665 | Protein ID | WP_002367500.1 |
Coordinates | 2771238..2771468 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYW42_RS13655 (2766912) | 2766912..2770526 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
PYW42_RS13660 (2770897) | 2770897..2771238 | - | 342 | WP_002360937.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PYW42_RS13665 (2771238) | 2771238..2771468 | - | 231 | WP_002367500.1 | hypothetical protein | Antitoxin |
PYW42_RS13670 (2771523) | 2771523..2771702 | - | 180 | WP_111997057.1 | hypothetical protein | - |
PYW42_RS13675 (2771882) | 2771882..2772097 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
PYW42_RS13680 (2772236) | 2772236..2773228 | + | 993 | WP_002389493.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
PYW42_RS13685 (2773492) | 2773492..2774130 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
PYW42_RS13690 (2774816) | 2774816..2776432 | + | 1617 | WP_002389442.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13165.41 Da Isoelectric Point: 9.3988
>T273656 WP_002360937.1 NZ_CP118962:c2771238-2770897 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2A7G9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S4CGQ1 |