Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/Peptidase_M78-HTH_19 |
Location | 2475789..2476483 | Replicon | chromosome |
Accession | NZ_CP118962 | ||
Organism | Enterococcus faecalis strain DSM 20478 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | A0A828QV40 |
Locus tag | PYW42_RS12345 | Protein ID | WP_002406159.1 |
Coordinates | 2476139..2476483 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | A0A828QTI6 |
Locus tag | PYW42_RS12340 | Protein ID | WP_002406160.1 |
Coordinates | 2475789..2476121 (+) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYW42_RS12305 (2471559) | 2471559..2472335 | - | 777 | WP_010816191.1 | DnaD domain protein | - |
PYW42_RS12310 (2472351) | 2472351..2473166 | - | 816 | WP_010816192.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
PYW42_RS12315 (2473129) | 2473129..2474094 | - | 966 | WP_010717378.1 | RecT family recombinase | - |
PYW42_RS12320 (2474195) | 2474195..2474419 | - | 225 | WP_002367281.1 | hypothetical protein | - |
PYW42_RS12325 (2474528) | 2474528..2474944 | - | 417 | WP_002370016.1 | hypothetical protein | - |
PYW42_RS12330 (2475138) | 2475138..2475281 | - | 144 | WP_002393055.1 | hypothetical protein | - |
PYW42_RS12335 (2475292) | 2475292..2475468 | - | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
PYW42_RS12340 (2475789) | 2475789..2476121 | + | 333 | WP_002406160.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PYW42_RS12345 (2476139) | 2476139..2476483 | + | 345 | WP_002406159.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
PYW42_RS12350 (2476571) | 2476571..2477002 | + | 432 | WP_010784248.1 | hypothetical protein | - |
PYW42_RS12355 (2477112) | 2477112..2478479 | + | 1368 | WP_002406157.1 | recombinase family protein | - |
PYW42_RS12360 (2478501) | 2478501..2479076 | - | 576 | WP_002393061.1 | DNA repair protein RadC | - |
PYW42_RS12365 (2479108) | 2479108..2479767 | - | 660 | WP_002398690.1 | HAD family hydrolase | - |
PYW42_RS12370 (2479751) | 2479751..2481073 | - | 1323 | WP_002410879.1 | folylpolyglutamate synthase/dihydrofolate synthase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2434292..2478479 | 44187 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13556.36 Da Isoelectric Point: 4.9882
>T273645 WP_002406159.1 NZ_CP118962:2476139-2476483 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLHKKACFESEHGVIFVNQNLSTEEQEEAIYHEFKHVKDHADLMALYNIPIFRSKMEAEAEH
YMFECLIEKNDGQFNYSNVITHYNLKMGQETYLK
MKSIKELVEEYNVELVFTTLHKKACFESEHGVIFVNQNLSTEEQEEAIYHEFKHVKDHADLMALYNIPIFRSKMEAEAEH
YMFECLIEKNDGQFNYSNVITHYNLKMGQETYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828QV40 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828QTI6 |