Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 412660..413242 | Replicon | chromosome |
| Accession | NZ_CP118962 | ||
| Organism | Enterococcus faecalis strain DSM 20478 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | A0A0M2AE74 |
| Locus tag | PYW42_RS02075 | Protein ID | WP_002355414.1 |
| Coordinates | 412934..413242 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL19 |
| Locus tag | PYW42_RS02070 | Protein ID | WP_002326825.1 |
| Coordinates | 412660..412932 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYW42_RS02040 (407941) | 407941..408669 | - | 729 | WP_002355404.1 | GntR family transcriptional regulator | - |
| PYW42_RS02045 (408846) | 408846..409772 | + | 927 | WP_002355406.1 | hypothetical protein | - |
| PYW42_RS02050 (409789) | 409789..411072 | + | 1284 | WP_002363033.1 | PTS sugar transporter subunit IIC | - |
| PYW42_RS02055 (411264) | 411264..411386 | + | 123 | Protein_381 | topoisomerase | - |
| PYW42_RS02060 (411461) | 411461..412357 | + | 897 | WP_002363034.1 | ParA family protein | - |
| PYW42_RS02065 (412434) | 412434..412643 | + | 210 | WP_002363035.1 | peptide-binding protein | - |
| PYW42_RS02070 (412660) | 412660..412932 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
| PYW42_RS02075 (412934) | 412934..413242 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
| PYW42_RS02080 (413322) | 413322..413729 | - | 408 | WP_224571294.1 | tyrosine-type recombinase/integrase | - |
| PYW42_RS02085 (413796) | 413796..414296 | - | 501 | WP_002363039.1 | HAD family hydrolase | - |
| PYW42_RS02090 (414301) | 414301..415068 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PYW42_RS02095 (415555) | 415555..415980 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
| PYW42_RS02100 (415997) | 415997..416512 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
| PYW42_RS02105 (416523) | 416523..417455 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T273642 WP_002355414.1 NZ_CP118962:412934-413242 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AE74 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AF93 |