Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2312655..2313633 | Replicon | chromosome |
Accession | NZ_CP118958 | ||
Organism | Bacillus mycoides strain DSM 2048 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | J8I6P2 |
Locus tag | PYW38_RS12035 | Protein ID | WP_002017051.1 |
Coordinates | 2312655..2313395 (+) | Length | 247 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | R8HWP4 |
Locus tag | PYW38_RS12040 | Protein ID | WP_000588712.1 |
Coordinates | 2313508..2313633 (+) | Length | 42 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYW38_RS12005 | 2307757..2308518 | + | 762 | WP_002127420.1 | ABC transporter ATP-binding protein | - |
PYW38_RS12010 | 2308624..2309334 | + | 711 | WP_002127421.1 | class I SAM-dependent methyltransferase | - |
PYW38_RS12015 | 2309453..2309866 | + | 414 | WP_002012925.1 | VOC family protein | - |
PYW38_RS12020 | 2310043..2310675 | - | 633 | WP_002017047.1 | type 1 glutamine amidotransferase family protein | - |
PYW38_RS12025 | 2310949..2311425 | + | 477 | WP_002017049.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PYW38_RS12030 | 2311579..2312316 | + | 738 | WP_002032137.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
PYW38_RS12035 | 2312655..2313395 | + | 741 | WP_002017051.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
PYW38_RS12040 | 2313508..2313633 | + | 126 | WP_000588712.1 | hypothetical protein | Antitoxin |
PYW38_RS12045 | 2313709..2313885 | + | 177 | WP_003189253.1 | stage II sporulation protein SB | - |
PYW38_RS12050 | 2313906..2314295 | - | 390 | WP_033733970.1 | YxeA family protein | - |
PYW38_RS12055 | 2314547..2316016 | + | 1470 | WP_003189257.1 | aminoacyl-histidine dipeptidase | - |
PYW38_RS12060 | 2316376..2316525 | + | 150 | WP_002069316.1 | hypothetical protein | - |
PYW38_RS12065 | 2317239..2317898 | + | 660 | WP_003189261.1 | CatB-related O-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 247 a.a. Molecular weight: 28512.20 Da Isoelectric Point: 8.3034
>T273640 WP_002017051.1 NZ_CP118958:2312655-2313395 [Bacillus mycoides]
MTISNIRIGLFILAIVFIVLVFFYWRNEELYEEKKQRIRKTWYGLFITSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIA
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPTAFGTMEWHTEEEYTKSLNTFLDSYGEKIGAK
IVVFEAVKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIH
HSYFSK
MTISNIRIGLFILAIVFIVLVFFYWRNEELYEEKKQRIRKTWYGLFITSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIA
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPTAFGTMEWHTEEEYTKSLNTFLDSYGEKIGAK
IVVFEAVKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIH
HSYFSK
Download Length: 741 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | J8I6P2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366GQT1 |