Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 245270..245912 | Replicon | chromosome |
| Accession | NZ_CP118958 | ||
| Organism | Bacillus mycoides strain DSM 2048 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | R8I8B8 |
| Locus tag | PYW38_RS01380 | Protein ID | WP_000635965.1 |
| Coordinates | 245562..245912 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | PYW38_RS01375 | Protein ID | WP_000004570.1 |
| Coordinates | 245270..245557 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYW38_RS01350 | 240435..241397 | + | 963 | WP_002009966.1 | UV DNA damage repair endonuclease UvsE | - |
| PYW38_RS01355 | 241564..242112 | - | 549 | WP_003186998.1 | rhomboid family intramembrane serine protease | - |
| PYW38_RS01360 | 242205..242564 | + | 360 | WP_002009969.1 | holo-ACP synthase | - |
| PYW38_RS01365 | 242721..243671 | + | 951 | WP_033734626.1 | outer membrane lipoprotein carrier protein LolA | - |
| PYW38_RS01370 | 243789..244958 | + | 1170 | WP_002124821.1 | alanine racemase | - |
| PYW38_RS01375 | 245270..245557 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| PYW38_RS01380 | 245562..245912 | + | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| PYW38_RS01385 | 245981..248149 | + | 2169 | WP_002124824.1 | Tex family protein | - |
| PYW38_RS01390 | 248207..248323 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| PYW38_RS01395 | 248534..248989 | + | 456 | WP_016095131.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T273639 WP_000635965.1 NZ_CP118958:245562-245912 [Bacillus mycoides]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366G118 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |