Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | sezT-pezT/zeta-couple_hipB |
Location | 1406024..1407288 | Replicon | chromosome |
Accession | NZ_CP118957 | ||
Organism | Enterococcus saccharolyticus subsp. saccharolyticus strain DSM 20726 |
Toxin (Protein)
Gene name | sezT | Uniprot ID | S0NXW2 |
Locus tag | PYW32_RS07325 | Protein ID | WP_016174967.1 |
Coordinates | 1406024..1406812 (-) | Length | 263 a.a. |
Antitoxin (Protein)
Gene name | pezT | Uniprot ID | - |
Locus tag | PYW32_RS07330 | Protein ID | WP_016174966.1 |
Coordinates | 1406812..1407288 (-) | Length | 159 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYW32_RS07295 | 1401720..1402007 | + | 288 | WP_016174973.1 | hypothetical protein | - |
PYW32_RS07300 | 1402178..1402411 | - | 234 | WP_016174972.1 | heavy-metal-associated domain-containing protein | - |
PYW32_RS07305 | 1402485..1404332 | - | 1848 | WP_016174971.1 | heavy metal translocating P-type ATPase | - |
PYW32_RS07310 | 1404384..1404686 | - | 303 | WP_016174970.1 | hypothetical protein | - |
PYW32_RS07315 | 1404851..1405600 | - | 750 | WP_016174969.1 | Crp/Fnr family transcriptional regulator | - |
PYW32_RS07320 | 1405822..1406034 | - | 213 | WP_016174968.1 | AAA family ATPase | - |
PYW32_RS07325 | 1406024..1406812 | - | 789 | WP_016174967.1 | type II toxin-antitoxin system toxin PezT | Toxin |
PYW32_RS07330 | 1406812..1407288 | - | 477 | WP_016174966.1 | type II toxin-antitoxin system antitoxin PezA | Antitoxin |
PYW32_RS07335 | 1407358..1407591 | - | 234 | Protein_1401 | hypothetical protein | - |
PYW32_RS07340 | 1407585..1407892 | - | 308 | Protein_1402 | transposase | - |
PYW32_RS07345 | 1407962..1408924 | - | 963 | WP_016174964.1 | hypothetical protein | - |
PYW32_RS07350 | 1408938..1409159 | - | 222 | WP_016174963.1 | YdbC family protein | - |
PYW32_RS07355 | 1409177..1409521 | - | 345 | WP_016174962.1 | nucleotide pyrophosphohydrolase | - |
PYW32_RS07360 | 1409563..1410771 | - | 1209 | WP_016174961.1 | DUF3578 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1403382..1487304 | 83922 | |
- | flank | IS/Tn | - | - | 1407599..1407892 | 293 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 263 a.a. Molecular weight: 29830.73 Da Isoelectric Point: 5.4749
>T273638 WP_016174967.1 NZ_CP118957:c1406812-1406024 [Enterococcus saccharolyticus subsp. saccharolyticus]
MRLEEFSEEEFQKALQRTIRALTRGKTIPGQPKAILLGGQSGAGKTTIHRIKQKEFQGNIIIIDGDSYRSQHPNYLALQE
KYGKDSVDYTKGFAGKMVEQLVDELSTQGYHLLIEGTLRTTQVPRQTAQLLASKGYQVSLAVIGTKSELSYLSTLIRYEE
LYAIDPNQARATPKEHHDGIVENLVDNLRELESEKLFEQIQIYQRDRACIYDSETDKDSAAEVLQDCLFGEWSKVEEEML
KLGRERLVKLNNKNLLESNYGI
MRLEEFSEEEFQKALQRTIRALTRGKTIPGQPKAILLGGQSGAGKTTIHRIKQKEFQGNIIIIDGDSYRSQHPNYLALQE
KYGKDSVDYTKGFAGKMVEQLVDELSTQGYHLLIEGTLRTTQVPRQTAQLLASKGYQVSLAVIGTKSELSYLSTLIRYEE
LYAIDPNQARATPKEHHDGIVENLVDNLRELESEKLFEQIQIYQRDRACIYDSETDKDSAAEVLQDCLFGEWSKVEEEML
KLGRERLVKLNNKNLLESNYGI
Download Length: 789 bp
Antitoxin
Download Length: 159 a.a. Molecular weight: 18252.66 Da Isoelectric Point: 4.3965
>AT273638 WP_016174966.1 NZ_CP118957:c1407288-1406812 [Enterococcus saccharolyticus subsp. saccharolyticus]
MIGDNIKSLRHTHDLTQPEFAKMVGISRNSLSRYENGTSTVSTELIDRICQKFNVSYIDIVGEDKMLTPVEDYQLTLKVE
VIKERGAAILSQLYRYQDSQDIAFDDEANPWILMSDDLAELINTKIYLVDTFDEIERYNGYLDGIERMLDMVHHRVVA
MIGDNIKSLRHTHDLTQPEFAKMVGISRNSLSRYENGTSTVSTELIDRICQKFNVSYIDIVGEDKMLTPVEDYQLTLKVE
VIKERGAAILSQLYRYQDSQDIAFDDEANPWILMSDDLAELINTKIYLVDTFDEIERYNGYLDGIERMLDMVHHRVVA
Download Length: 477 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|