Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 895746..896527 | Replicon | chromosome |
Accession | NZ_CP118953 | ||
Organism | Staphylococcus chromogenes strain DSM 20454 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | - |
Locus tag | PYW36_RS04370 | Protein ID | WP_157946077.1 |
Coordinates | 896363..896527 (+) | Length | 55 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | PYW36_RS04365 | Protein ID | WP_037577237.1 |
Coordinates | 895746..896345 (+) | Length | 200 a.a. |
Genomic Context
Location: 891930..892652 (723 bp)
Type: Others
Protein ID: WP_037577247.1
Type: Others
Protein ID: WP_037577247.1
Location: 892940..894073 (1134 bp)
Type: Others
Protein ID: WP_037577244.1
Type: Others
Protein ID: WP_037577244.1
Location: 894070..894540 (471 bp)
Type: Others
Protein ID: WP_037577242.1
Type: Others
Protein ID: WP_037577242.1
Location: 894558..895727 (1170 bp)
Type: Others
Protein ID: WP_103159618.1
Type: Others
Protein ID: WP_103159618.1
Location: 895746..896345 (600 bp)
Type: Antitoxin
Protein ID: WP_037577237.1
Type: Antitoxin
Protein ID: WP_037577237.1
Location: 896363..896527 (165 bp)
Type: Toxin
Protein ID: WP_157946077.1
Type: Toxin
Protein ID: WP_157946077.1
Location: 896627..897037 (411 bp)
Type: Others
Protein ID: WP_103159619.1
Type: Others
Protein ID: WP_103159619.1
Location: 897182..898567 (1386 bp)
Type: Others
Protein ID: WP_037577233.1
Type: Others
Protein ID: WP_037577233.1
Location: 898589..900115 (1527 bp)
Type: Others
Protein ID: WP_103159620.1
Type: Others
Protein ID: WP_103159620.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYW36_RS04345 | 891930..892652 | + | 723 | WP_037577247.1 | amino acid ABC transporter ATP-binding protein | - |
PYW36_RS04350 | 892940..894073 | + | 1134 | WP_037577244.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
PYW36_RS04355 | 894070..894540 | + | 471 | WP_037577242.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
PYW36_RS04360 | 894558..895727 | + | 1170 | WP_103159618.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
PYW36_RS04365 | 895746..896345 | + | 600 | WP_037577237.1 | glucosamine-6-phosphate isomerase | Antitoxin |
PYW36_RS04370 | 896363..896527 | + | 165 | WP_157946077.1 | SAS053 family protein | Toxin |
PYW36_RS04375 | 896627..897037 | + | 411 | WP_103159619.1 | hypothetical protein | - |
PYW36_RS04380 | 897182..898567 | + | 1386 | WP_037577233.1 | class II fumarate hydratase | - |
PYW36_RS04385 | 898589..900115 | + | 1527 | WP_103159620.1 | exopolyphosphatase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 55 a.a. Molecular weight: 6336.67 Da Isoelectric Point: 3.8825
>T273635 WP_157946077.1 NZ_CP118953:896363-896527 [Staphylococcus chromogenes]
MTEEKHIEHENEMVDDFDDLVSLGKEMEQISEANDEEKENQTHDASIRSDKTEE
MTEEKHIEHENEMVDDFDDLVSLGKEMEQISEANDEEKENQTHDASIRSDKTEE
Download Length: 165 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22353.29 Da Isoelectric Point: 6.1496
>AT273635 WP_037577237.1 NZ_CP118953:895746-896345 [Staphylococcus chromogenes]
MAMNFKVFKDKDTAAIYAADIIRKQFNNNPTTIAGFHLSGEEAPVLDYLKRNVDNHAVDFSQIHVLDYDKQTSYFKALGV
PEKQIHEIPEDDDVEKFIEHKAKTKDNKGKLTLQVVSINQNGEFGVPVNNGLKPAREIFVIVTGHDKADVIKKLYEDNGN
TSFIPSSLKTHRMVNVILDEAAAQGLPADVREYFTSLYA
MAMNFKVFKDKDTAAIYAADIIRKQFNNNPTTIAGFHLSGEEAPVLDYLKRNVDNHAVDFSQIHVLDYDKQTSYFKALGV
PEKQIHEIPEDDDVEKFIEHKAKTKDNKGKLTLQVVSINQNGEFGVPVNNGLKPAREIFVIVTGHDKADVIKKLYEDNGN
TSFIPSSLKTHRMVNVILDEAAAQGLPADVREYFTSLYA
Download Length: 600 bp