Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 756722..757246 | Replicon | chromosome |
Accession | NZ_CP118953 | ||
Organism | Staphylococcus chromogenes strain DSM 20454 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PYW36_RS03565 | Protein ID | WP_103159488.1 |
Coordinates | 756893..757246 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A3A0K2V6 |
Locus tag | PYW36_RS03560 | Protein ID | WP_037577177.1 |
Coordinates | 756722..756892 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYW36_RS03535 | 752570..753043 | + | 474 | WP_051605022.1 | PH domain-containing protein | - |
PYW36_RS03540 | 753036..754514 | + | 1479 | WP_037577183.1 | PH domain-containing protein | - |
PYW36_RS03545 | 754511..755026 | + | 516 | WP_051605021.1 | PH domain-containing protein | - |
PYW36_RS03550 | 755023..755373 | + | 351 | WP_037577181.1 | holo-ACP synthase | - |
PYW36_RS03555 | 755489..756637 | + | 1149 | WP_103159487.1 | alanine racemase | - |
PYW36_RS03560 | 756722..756892 | + | 171 | WP_037577177.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PYW36_RS03565 | 756893..757246 | + | 354 | WP_103159488.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PYW36_RS03570 | 757310..758314 | + | 1005 | WP_037577174.1 | PP2C family protein-serine/threonine phosphatase | - |
PYW36_RS03575 | 758395..758721 | + | 327 | WP_037577172.1 | anti-sigma factor antagonist | - |
PYW36_RS03580 | 758724..759203 | + | 480 | WP_037577169.1 | anti-sigma B factor RsbW | - |
PYW36_RS03585 | 759178..759948 | + | 771 | WP_037577167.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13064.34 Da Isoelectric Point: 10.5127
>T273634 WP_103159488.1 NZ_CP118953:756893-757246 [Staphylococcus chromogenes]
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIDKKKYKLDKDSVILLEQIRT
VDKKRLKEKLTFLSDKKMKEVNAALGISLGLHMNQHK
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIDKKKYKLDKDSVILLEQIRT
VDKKRLKEKLTFLSDKKMKEVNAALGISLGLHMNQHK
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|