Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 6216..6735 Replicon plasmid pK524-NR
Accession NZ_CP118941
Organism Aeromonas caviae strain K524

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PY772_RS24875 Protein ID WP_113722067.1
Coordinates 6448..6735 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PY772_RS24870 Protein ID WP_201873143.1
Coordinates 6216..6458 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PY772_RS24840 (PY772_24840) 1356..2414 + 1059 WP_029313567.1 porin -
PY772_RS24845 (PY772_24845) 2474..3160 - 687 WP_270805053.1 class I SAM-dependent methyltransferase -
PY772_RS24850 (PY772_24850) 3169..4116 - 948 WP_031285326.1 IS30 family transposase -
PY772_RS24855 (PY772_24855) 4254..4568 + 315 WP_201873150.1 hypothetical protein -
PY772_RS24860 (PY772_24860) 4909..5049 - 141 WP_201873147.1 hypothetical protein -
PY772_RS24865 (PY772_24865) 5175..5687 - 513 WP_201873144.1 hypothetical protein -
PY772_RS24870 (PY772_24870) 6216..6458 + 243 WP_201873143.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PY772_RS24875 (PY772_24875) 6448..6735 + 288 WP_113722067.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PY772_RS24880 (PY772_24880) 6785..7126 + 342 WP_161508008.1 type II toxin-antitoxin system CcdA family antitoxin -
PY772_RS24885 (PY772_24885) 7823..8836 + 1014 WP_223954343.1 replication initiation protein -
PY772_RS24890 (PY772_24890) 9029..9271 - 243 WP_103859311.1 plasmid replication protein RepB -
PY772_RS24895 (PY772_24895) 9330..9614 - 285 WP_128274411.1 hypothetical protein -
PY772_RS24900 (PY772_24900) 9624..10532 - 909 WP_254241371.1 integrase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..12292 12292


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(2-62)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11280.08 Da        Isoelectric Point: 9.9994

>T273625 WP_113722067.1 NZ_CP118941:6448-6735 [Aeromonas caviae]
MTFELEFDPRAWKEWKKLGDTVRQQFKKKLAEVLERPRVEANRLHGLPDCYKIKLRGAGYRLVYQVQDDRVLVFVVAVGK
REREQVYLDAGSRLE

Download         Length: 288 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9041.33 Da        Isoelectric Point: 4.5881

>AT273625 WP_201873143.1 NZ_CP118941:6216-6458 [Aeromonas caviae]
MGTINLRIDDDLKARSYAVLDRLGVTPSELLRQTLEYVASQERLPFRTTVVTEDEEALLALVRERLASPQKGIRVSLDDL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References