Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yoeB-relB/YoeB-YefM
Location 151194..151696 Replicon plasmid pK524-KPC
Accession NZ_CP118940
Organism Aeromonas caviae strain K524

Toxin (Protein)


Gene name yoeB Uniprot ID Q5XQD8
Locus tag PY772_RS24510 Protein ID WP_032492620.1
Coordinates 151442..151696 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A1V0BEH6
Locus tag PY772_RS24505 Protein ID WP_032492621.1
Coordinates 151194..151445 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PY772_RS24485 (PY772_24485) 147095..148636 - 1542 WP_000050481.1 IS91-like element ISCR1 family transposase -
PY772_RS24490 (PY772_24490) 149041..149880 - 840 WP_000259031.1 sulfonamide-resistant dihydropteroate synthase Sul1 -
PY772_RS24495 (PY772_24495) 149874..150221 - 348 WP_000679427.1 quaternary ammonium compound efflux SMR transporter QacE delta 1 -
PY772_RS24500 (PY772_24500) 150378..151010 - 633 WP_000186237.1 type B-3 chloramphenicol O-acetyltransferase CatB3 -
PY772_RS24505 (PY772_24505) 151194..151445 + 252 WP_032492621.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
PY772_RS24510 (PY772_24510) 151442..151696 + 255 WP_032492620.1 Txe/YoeB family addiction module toxin Toxin
PY772_RS24515 (PY772_24515) 151769..152323 - 555 WP_012695458.1 AAC(6')-Ib family aminoglycoside 6'-N-acetyltransferase -
PY772_RS24520 (PY772_24520) 152357..153160 - 804 Protein_149 AadA family aminoglycoside 3''-O-nucleotidyltransferase -
PY772_RS24525 (PY772_24525) 153407..154420 + 1014 WP_000845048.1 class 1 integron integrase IntI1 -
PY772_RS24530 (PY772_24530) 154757..155317 + 561 WP_001161490.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B / mph(A) / sul1 / blaKPC-2 / blaPER-3 / qacE / catB3 / ant(3'')-Ii-aac(6')-IId / aph(6)-Id / aph(3'')-Ib - 1..220105 220105
- inside IScluster/Tn mph(A) / sul1 / blaKPC-2 / blaPER-3 / qacE / catB3 / ant(3'')-Ii-aac(6')-IId / aph(6)-Id / aph(3'')-Ib - 111070..165395 54325
- inside Integron catB3 / qacE - 149874..154420 4546


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 10272.81 Da        Isoelectric Point: 9.3585

>T273624 WP_032492620.1 NZ_CP118940:151442-151696 [Aeromonas caviae]
MRLIFSDDAWEDYLFWQKQDRRMVDRINKLIKETTREPFSGVGKPEPLKHALAGYWSRRITDEHRMVYKVADDALWIVQL
KYHY

Download         Length: 255 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9244.40 Da        Isoelectric Point: 4.7769

>AT273624 WP_032492621.1 NZ_CP118940:151194-151445 [Aeromonas caviae]
MDAITYTHARANLAGTMDRVCNDHEPVIITRNGDQSVVILSLEDFQALEETAYLLRSPANAKRLFKSIEQLEAGRGQARE
LAE

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1V0BEH9

Antitoxin

Source ID Structure
AlphaFold DB A0A1V0BEH6

References