Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 130970..131538 | Replicon | plasmid pK524-KPC |
| Accession | NZ_CP118940 | ||
| Organism | Aeromonas caviae strain K524 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | PY772_RS24415 | Protein ID | WP_101617266.1 |
| Coordinates | 130970..131263 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PY772_RS24420 | Protein ID | WP_101617265.1 |
| Coordinates | 131251..131538 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PY772_RS24390 (PY772_24390) | 127630..127902 | - | 273 | WP_139743096.1 | hypothetical protein | - |
| PY772_RS24395 (PY772_24395) | 127923..128066 | - | 144 | WP_275059513.1 | hypothetical protein | - |
| PY772_RS24400 (PY772_24400) | 128233..129843 | - | 1611 | WP_052814785.1 | IS66 family transposase | - |
| PY772_RS24405 (PY772_24405) | 129893..130258 | - | 366 | WP_042012890.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PY772_RS24410 (PY772_24410) | 130258..130566 | - | 309 | WP_042012893.1 | hypothetical protein | - |
| PY772_RS24415 (PY772_24415) | 130970..131263 | - | 294 | WP_101617266.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PY772_RS24420 (PY772_24420) | 131251..131538 | - | 288 | WP_101617265.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PY772_RS24425 (PY772_24425) | 131794..134811 | - | 3018 | WP_021740570.1 | Tn3-like element IS3000 family transposase | - |
| PY772_RS24430 (PY772_24430) | 134955..135812 | + | 858 | Protein_131 | IS481-like element ISKpn27 family transposase | - |
| PY772_RS24435 (PY772_24435) | 135887..136537 | + | 651 | WP_045286946.1 | class A beta-lactamase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaTEM-1B / mph(A) / sul1 / blaKPC-2 / blaPER-3 / qacE / catB3 / ant(3'')-Ii-aac(6')-IId / aph(6)-Id / aph(3'')-Ib | - | 1..220105 | 220105 | |
| - | inside | IScluster/Tn | mph(A) / sul1 / blaKPC-2 / blaPER-3 / qacE / catB3 / ant(3'')-Ii-aac(6')-IId / aph(6)-Id / aph(3'')-Ib | - | 111070..165395 | 54325 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10980.79 Da Isoelectric Point: 10.6871
>T273623 WP_101617266.1 NZ_CP118940:c131263-130970 [Aeromonas caviae]
MPPVIFAPAALRDLQRLREFLRPKSPQVAQRAATTIQLSLRQLAAQPSMGRPIEGLPEAFREWVIPFGDSGYLARYRIEP
DVIVVLAVRHQREVGYS
MPPVIFAPAALRDLQRLREFLRPKSPQVAQRAATTIQLSLRQLAAQPSMGRPIEGLPEAFREWVIPFGDSGYLARYRIEP
DVIVVLAVRHQREVGYS
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|