Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 44561..45297 | Replicon | plasmid pRX.G5M15_1 |
Accession | NZ_CP118937 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain RX.G5M15 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A443XD13 |
Locus tag | PX704_RS25515 | Protein ID | WP_075253142.1 |
Coordinates | 44815..45297 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | PX704_RS25510 | Protein ID | WP_003026799.1 |
Coordinates | 44561..44827 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PX704_RS25500 (PX704_25505) | 40494..42125 | - | 1632 | WP_087846553.1 | carbohydrate porin | - |
PX704_RS25505 (PX704_25510) | 42545..43513 | + | 969 | WP_275107659.1 | IS5 family transposase | - |
PX704_RS25510 (PX704_25515) | 44561..44827 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
PX704_RS25515 (PX704_25520) | 44815..45297 | + | 483 | WP_075253142.1 | GNAT family N-acetyltransferase | Toxin |
PX704_RS25520 (PX704_25525) | 45469..47001 | + | 1533 | WP_275107661.1 | IS3-like element ISKpn38 family transposase | - |
PX704_RS25525 (PX704_25530) | 47027..47383 | - | 357 | Protein_47 | transposase | - |
PX704_RS25530 (PX704_25535) | 48004..49173 | + | 1170 | WP_048977890.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..152213 | 152213 | |
- | inside | IScluster/Tn | - | - | 42545..47383 | 4838 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17254.90 Da Isoelectric Point: 8.7400
>T273618 WP_075253142.1 NZ_CP118937:44815-45297 [Klebsiella pneumoniae subsp. pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A443XD13 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |