Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5136093..5136718 | Replicon | chromosome |
Accession | NZ_CP118936 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain RX.G5M15 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | PX704_RS24860 | Protein ID | WP_002882817.1 |
Coordinates | 5136093..5136476 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | PX704_RS24865 | Protein ID | WP_004150355.1 |
Coordinates | 5136476..5136718 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PX704_RS24845 (5133459) | 5133459..5134361 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
PX704_RS24850 (5134358) | 5134358..5134993 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
PX704_RS24855 (5134990) | 5134990..5135919 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
PX704_RS24860 (5136093) | 5136093..5136476 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PX704_RS24865 (5136476) | 5136476..5136718 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
PX704_RS24870 (5136923) | 5136923..5137840 | + | 918 | WP_032422045.1 | alpha/beta hydrolase | - |
PX704_RS24875 (5137854) | 5137854..5138795 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
PX704_RS24880 (5138840) | 5138840..5139277 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
PX704_RS24885 (5139274) | 5139274..5140134 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
PX704_RS24890 (5140128) | 5140128..5140727 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T273617 WP_002882817.1 NZ_CP118936:c5136476-5136093 [Klebsiella pneumoniae subsp. pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |