Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4649972..4650488 | Replicon | chromosome |
Accession | NZ_CP118936 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain RX.G5M15 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | PX704_RS22550 | Protein ID | WP_009486548.1 |
Coordinates | 4649972..4650256 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | PX704_RS22555 | Protein ID | WP_002886901.1 |
Coordinates | 4650246..4650488 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PX704_RS22525 (4645368) | 4645368..4645631 | - | 264 | WP_228938441.1 | PTS sugar transporter subunit IIB | - |
PX704_RS22530 (4645761) | 4645761..4645934 | + | 174 | WP_032408826.1 | hypothetical protein | - |
PX704_RS22535 (4645937) | 4645937..4646680 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
PX704_RS22540 (4647037) | 4647037..4649175 | + | 2139 | WP_040164650.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PX704_RS22545 (4649504) | 4649504..4649968 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PX704_RS22550 (4649972) | 4649972..4650256 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PX704_RS22555 (4650246) | 4650246..4650488 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PX704_RS22560 (4650566) | 4650566..4652476 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
PX704_RS22565 (4652499) | 4652499..4653650 | - | 1152 | WP_275107564.1 | lactonase family protein | - |
PX704_RS22570 (4653717) | 4653717..4654457 | - | 741 | WP_004206507.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T273616 WP_009486548.1 NZ_CP118936:c4650256-4649972 [Klebsiella pneumoniae subsp. pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |