Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 4543734..4544544 | Replicon | chromosome |
| Accession | NZ_CP118936 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain RX.G5M15 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | PX704_RS22110 | Protein ID | WP_048299784.1 |
| Coordinates | 4543734..4544267 (-) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | J2E9Q7 |
| Locus tag | PX704_RS22115 | Protein ID | WP_002887278.1 |
| Coordinates | 4544278..4544544 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PX704_RS22105 (4542565) | 4542565..4543686 | + | 1122 | WP_004214138.1 | cupin domain-containing protein | - |
| PX704_RS22110 (4543734) | 4543734..4544267 | - | 534 | WP_048299784.1 | type II toxin-antitoxin system toxin KacT | Toxin |
| PX704_RS22115 (4544278) | 4544278..4544544 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
| PX704_RS22120 (4544647) | 4544647..4546080 | - | 1434 | WP_040210879.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
| PX704_RS22125 (4546070) | 4546070..4546753 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
| PX704_RS22130 (4546925) | 4546925..4548310 | + | 1386 | WP_040089708.1 | efflux transporter outer membrane subunit | - |
| PX704_RS22135 (4548328) | 4548328..4548672 | + | 345 | WP_023287080.1 | cation efflux system protein CusF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19826.65 Da Isoelectric Point: 5.2614
>T273615 WP_048299784.1 NZ_CP118936:c4544267-4543734 [Klebsiella pneumoniae subsp. pneumoniae]
MEQQLTIEMIADAFSYDITGYDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGYDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|