Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3918046..3918665 Replicon chromosome
Accession NZ_CP118936
Organism Klebsiella pneumoniae subsp. pneumoniae strain RX.G5M15

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag PX704_RS19130 Protein ID WP_002892050.1
Coordinates 3918447..3918665 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag PX704_RS19125 Protein ID WP_002892066.1
Coordinates 3918046..3918420 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PX704_RS19115 (3913198) 3913198..3914391 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PX704_RS19120 (3914414) 3914414..3917560 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
PX704_RS19125 (3918046) 3918046..3918420 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
PX704_RS19130 (3918447) 3918447..3918665 + 219 WP_002892050.1 HHA domain-containing protein Toxin
PX704_RS19135 (3918828) 3918828..3919394 + 567 WP_002892030.1 maltose O-acetyltransferase -
PX704_RS19140 (3919366) 3919366..3919506 - 141 WP_004147370.1 hypothetical protein -
PX704_RS19145 (3919527) 3919527..3919997 + 471 WP_002892026.1 YlaC family protein -
PX704_RS19150 (3919972) 3919972..3921423 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
PX704_RS19155 (3921524) 3921524..3922222 + 699 WP_002892021.1 GNAT family protein -
PX704_RS19160 (3922219) 3922219..3922359 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
PX704_RS19165 (3922359) 3922359..3922622 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T273614 WP_002892050.1 NZ_CP118936:3918447-3918665 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT273614 WP_002892066.1 NZ_CP118936:3918046-3918420 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References