Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1751932..1752522 | Replicon | chromosome |
Accession | NZ_CP118936 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain RX.G5M15 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | PX704_RS08405 | Protein ID | WP_023341911.1 |
Coordinates | 1752190..1752522 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A3S7DDD0 |
Locus tag | PX704_RS08400 | Protein ID | WP_000288812.1 |
Coordinates | 1751932..1752189 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PX704_RS08375 (1747842) | 1747842..1747916 | + | 75 | Protein_1638 | type II toxin-antitoxin system PemK/MazF family toxin | - |
PX704_RS08380 (1748267) | 1748267..1750015 | + | 1749 | WP_275107605.1 | hypothetical protein | - |
PX704_RS08385 (1750094) | 1750094..1750651 | + | 558 | WP_087638062.1 | hypothetical protein | - |
PX704_RS08390 (1750934) | 1750934..1751394 | + | 461 | Protein_1641 | hypothetical protein | - |
PX704_RS08395 (1751391) | 1751391..1751597 | + | 207 | WP_022615589.1 | helix-turn-helix transcriptional regulator | - |
PX704_RS08400 (1751932) | 1751932..1752189 | + | 258 | WP_000288812.1 | antitoxin | Antitoxin |
PX704_RS08405 (1752190) | 1752190..1752522 | + | 333 | WP_023341911.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PX704_RS08415 (1752844) | 1752844..1754280 | + | 1437 | WP_004151469.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
PX704_RS08425 (1754646) | 1754646..1756100 | - | 1455 | WP_004148975.1 | AMP nucleosidase | - |
PX704_RS08430 (1756230) | 1756230..1756475 | - | 246 | WP_023284006.1 | signal transduction protein PmrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11927.87 Da Isoelectric Point: 10.4722
>T273608 WP_023341911.1 NZ_CP118936:1752190-1752522 [Klebsiella pneumoniae subsp. pneumoniae]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDVVVNEVLARLDAMLS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDVVVNEVLARLDAMLS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|