Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 3498378..3499031 | Replicon | chromosome |
| Accession | NZ_CP118933 | ||
| Organism | Acinetobacter pittii strain ML4 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A009H1K7 |
| Locus tag | PX335_RS16745 | Protein ID | WP_017386980.1 |
| Coordinates | 3498378..3498767 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A009HHW9 |
| Locus tag | PX335_RS16750 | Protein ID | WP_002117064.1 |
| Coordinates | 3498774..3499031 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PX335_RS16730 (PX335_16725) | 3493469..3495679 | - | 2211 | WP_017386978.1 | TRAP transporter large permease subunit | - |
| PX335_RS16735 (PX335_16730) | 3495859..3496434 | - | 576 | WP_005078319.1 | rhombosortase | - |
| PX335_RS16740 (PX335_16735) | 3496519..3497607 | - | 1089 | WP_017386979.1 | hypothetical protein | - |
| PX335_RS16745 (PX335_16740) | 3498378..3498767 | - | 390 | WP_017386980.1 | hypothetical protein | Toxin |
| PX335_RS16750 (PX335_16745) | 3498774..3499031 | - | 258 | WP_002117064.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| PX335_RS16755 (PX335_16750) | 3499220..3500392 | + | 1173 | WP_017386981.1 | acyl-CoA dehydrogenase family protein | - |
| PX335_RS16760 (PX335_16755) | 3500443..3501933 | - | 1491 | WP_017386982.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| PX335_RS16765 (PX335_16760) | 3502115..3502492 | - | 378 | WP_002049717.1 | 50S ribosomal protein L17 | - |
| PX335_RS16770 (PX335_16765) | 3502511..3503518 | - | 1008 | WP_002116730.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15509.60 Da Isoelectric Point: 8.7390
>T273603 WP_017386980.1 NZ_CP118933:c3498767-3498378 [Acinetobacter pittii]
MIKELNFELKYSRVSVIFQLFVGLGLAILLYQLLTLIWWLCAVILLFIGSIFFLKQAQISQIEYLDQKLWSVAYFSKKEI
YRAEITKIIDYQLFVVIYFEETPTNIAIVWFDQLPIQQWKRLKVLEKLY
MIKELNFELKYSRVSVIFQLFVGLGLAILLYQLLTLIWWLCAVILLFIGSIFFLKQAQISQIEYLDQKLWSVAYFSKKEI
YRAEITKIIDYQLFVVIYFEETPTNIAIVWFDQLPIQQWKRLKVLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A009H1K7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A009HHW9 |