Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4135837..4136506 | Replicon | chromosome |
| Accession | NZ_CP118932 | ||
| Organism | Serratia marcescens strain RX11 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | PXW05_RS19800 | Protein ID | WP_265261371.1 |
| Coordinates | 4135837..4136259 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A8G2G4M4 |
| Locus tag | PXW05_RS19805 | Protein ID | WP_004931679.1 |
| Coordinates | 4136240..4136506 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXW05_RS19780 (PXW05_19780) | 4131766..4133499 | - | 1734 | WP_004931690.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PXW05_RS19785 (PXW05_19785) | 4133506..4134222 | - | 717 | WP_004931688.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PXW05_RS19790 (PXW05_19790) | 4134249..4135148 | - | 900 | WP_048795302.1 | site-specific tyrosine recombinase XerD | - |
| PXW05_RS19795 (PXW05_19795) | 4135255..4135773 | + | 519 | WP_004931683.1 | flavodoxin FldB | - |
| PXW05_RS19800 (PXW05_19800) | 4135837..4136259 | - | 423 | WP_265261371.1 | protein YgfX | Toxin |
| PXW05_RS19805 (PXW05_19805) | 4136240..4136506 | - | 267 | WP_004931679.1 | FAD assembly factor SdhE | Antitoxin |
| PXW05_RS19810 (PXW05_19810) | 4136827..4137819 | + | 993 | WP_265261370.1 | tRNA-modifying protein YgfZ | - |
| PXW05_RS19815 (PXW05_19815) | 4137858..4138355 | - | 498 | WP_004931675.1 | DUF2165 domain-containing protein | - |
| PXW05_RS19820 (PXW05_19820) | 4138506..4139180 | - | 675 | WP_021505704.1 | hemolysin III family protein | - |
| PXW05_RS19825 (PXW05_19825) | 4139364..4139972 | + | 609 | WP_004931670.1 | HD domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16519.59 Da Isoelectric Point: 10.9963
>T273601 WP_265261371.1 NZ_CP118932:c4136259-4135837 [Serratia marcescens]
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLHPPAGDGEQD
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLHPPAGDGEQD
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|