Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3782310..3782966 | Replicon | chromosome |
Accession | NZ_CP118932 | ||
Organism | Serratia marcescens strain RX11 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PXW05_RS18145 | Protein ID | WP_021504433.1 |
Coordinates | 3782310..3782699 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A8G2LCA8 |
Locus tag | PXW05_RS18150 | Protein ID | WP_004941563.1 |
Coordinates | 3782703..3782966 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXW05_RS18130 (PXW05_18130) | 3778777..3780207 | + | 1431 | WP_275095075.1 | multidrug transporter subunit MdtD | - |
PXW05_RS18135 (PXW05_18135) | 3780204..3781586 | + | 1383 | WP_021504432.1 | two-component system sensor histidine kinase BaeS | - |
PXW05_RS18140 (PXW05_18140) | 3781586..3782302 | + | 717 | WP_197753782.1 | two-component system response regulator BaeR | - |
PXW05_RS18145 (PXW05_18145) | 3782310..3782699 | - | 390 | WP_021504433.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PXW05_RS18150 (PXW05_18150) | 3782703..3782966 | - | 264 | WP_004941563.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PXW05_RS18155 (PXW05_18155) | 3783304..3783642 | + | 339 | WP_004941561.1 | YegP family protein | - |
PXW05_RS18160 (PXW05_18160) | 3783821..3785173 | + | 1353 | WP_004941558.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
PXW05_RS18165 (PXW05_18165) | 3785640..3786545 | + | 906 | WP_015378742.1 | lipid kinase YegS | - |
PXW05_RS18170 (PXW05_18170) | 3786714..3787928 | + | 1215 | WP_275095076.1 | D-galactonate dehydratase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14398.63 Da Isoelectric Point: 8.4983
>T273599 WP_021504433.1 NZ_CP118932:c3782699-3782310 [Serratia marcescens]
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELRYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELRYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|