Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1027261..1027882 | Replicon | chromosome |
| Accession | NZ_CP118932 | ||
| Organism | Serratia marcescens strain RX11 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A8B4G7F9 |
| Locus tag | PXW05_RS04865 | Protein ID | WP_004940313.1 |
| Coordinates | 1027261..1027464 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A2X2G5J9 |
| Locus tag | PXW05_RS04870 | Protein ID | WP_004940312.1 |
| Coordinates | 1027514..1027882 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXW05_RS04835 (PXW05_04835) | 1022960..1023298 | + | 339 | WP_004940327.1 | P-II family nitrogen regulator | - |
| PXW05_RS04840 (PXW05_04840) | 1023335..1024621 | + | 1287 | WP_004940322.1 | ammonium transporter AmtB | - |
| PXW05_RS04845 (PXW05_04845) | 1024712..1025575 | - | 864 | WP_004940320.1 | acyl-CoA thioesterase II | - |
| PXW05_RS04850 (PXW05_04850) | 1025807..1026298 | + | 492 | WP_004940318.1 | YbaY family lipoprotein | - |
| PXW05_RS04855 (PXW05_04855) | 1026363..1026677 | - | 315 | WP_004940317.1 | MGMT family protein | - |
| PXW05_RS04865 (PXW05_04865) | 1027261..1027464 | - | 204 | WP_004940313.1 | HHA domain-containing protein | Toxin |
| PXW05_RS04870 (PXW05_04870) | 1027514..1027882 | - | 369 | WP_004940312.1 | Hha toxicity modulator TomB | Antitoxin |
| PXW05_RS04875 (PXW05_04875) | 1028041..1028394 | - | 354 | WP_004940311.1 | hypothetical protein | - |
| PXW05_RS04880 (PXW05_04880) | 1028798..1029511 | + | 714 | WP_004940310.1 | ABC transporter ATP-binding protein | - |
| PXW05_RS04885 (PXW05_04885) | 1029508..1030365 | + | 858 | WP_004940309.1 | metal ABC transporter permease | - |
| PXW05_RS04890 (PXW05_04890) | 1030391..1031269 | + | 879 | WP_049188635.1 | metal ABC transporter substrate-binding protein | - |
| PXW05_RS04895 (PXW05_04895) | 1031377..1031517 | - | 141 | WP_004940304.1 | type B 50S ribosomal protein L36 | - |
| PXW05_RS04900 (PXW05_04900) | 1031530..1031784 | - | 255 | WP_004940303.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8107.37 Da Isoelectric Point: 6.9756
>T273593 WP_004940313.1 NZ_CP118932:c1027464-1027261 [Serratia marcescens]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14261.95 Da Isoelectric Point: 4.4314
>AT273593 WP_004940312.1 NZ_CP118932:c1027882-1027514 [Serratia marcescens]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4G7F9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2X2G5J9 |