Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1027261..1027882 Replicon chromosome
Accession NZ_CP118932
Organism Serratia marcescens strain RX11

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag PXW05_RS04865 Protein ID WP_004940313.1
Coordinates 1027261..1027464 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag PXW05_RS04870 Protein ID WP_004940312.1
Coordinates 1027514..1027882 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXW05_RS04835 (PXW05_04835) 1022960..1023298 + 339 WP_004940327.1 P-II family nitrogen regulator -
PXW05_RS04840 (PXW05_04840) 1023335..1024621 + 1287 WP_004940322.1 ammonium transporter AmtB -
PXW05_RS04845 (PXW05_04845) 1024712..1025575 - 864 WP_004940320.1 acyl-CoA thioesterase II -
PXW05_RS04850 (PXW05_04850) 1025807..1026298 + 492 WP_004940318.1 YbaY family lipoprotein -
PXW05_RS04855 (PXW05_04855) 1026363..1026677 - 315 WP_004940317.1 MGMT family protein -
PXW05_RS04865 (PXW05_04865) 1027261..1027464 - 204 WP_004940313.1 HHA domain-containing protein Toxin
PXW05_RS04870 (PXW05_04870) 1027514..1027882 - 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
PXW05_RS04875 (PXW05_04875) 1028041..1028394 - 354 WP_004940311.1 hypothetical protein -
PXW05_RS04880 (PXW05_04880) 1028798..1029511 + 714 WP_004940310.1 ABC transporter ATP-binding protein -
PXW05_RS04885 (PXW05_04885) 1029508..1030365 + 858 WP_004940309.1 metal ABC transporter permease -
PXW05_RS04890 (PXW05_04890) 1030391..1031269 + 879 WP_049188635.1 metal ABC transporter substrate-binding protein -
PXW05_RS04895 (PXW05_04895) 1031377..1031517 - 141 WP_004940304.1 type B 50S ribosomal protein L36 -
PXW05_RS04900 (PXW05_04900) 1031530..1031784 - 255 WP_004940303.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T273593 WP_004940313.1 NZ_CP118932:c1027464-1027261 [Serratia marcescens]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT273593 WP_004940312.1 NZ_CP118932:c1027882-1027514 [Serratia marcescens]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References