Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 1507259..1507818 Replicon chromosome
Accession NZ_CP118930
Organism Vibrio alginolyticus strain V208

Toxin (Protein)


Gene name relE Uniprot ID A0A347UR22
Locus tag O6P42_RS07725 Protein ID WP_005398411.1
Coordinates 1507259..1507537 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR21
Locus tag O6P42_RS07730 Protein ID WP_005398409.1
Coordinates 1507534..1507818 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O6P42_RS07685 (O6P42_07685) 1502488..1502578 + 91 Protein_1436 DUF3265 domain-containing protein -
O6P42_RS07690 (O6P42_07690) 1503099..1504097 + 999 WP_104979324.1 alpha/beta fold hydrolase -
O6P42_RS07695 (O6P42_07695) 1504112..1504204 + 93 WP_115386054.1 DUF3265 domain-containing protein -
O6P42_RS07700 (O6P42_07700) 1504665..1504754 + 90 WP_080262357.1 DUF3265 domain-containing protein -
O6P42_RS07705 (O6P42_07705) 1504781..1505290 + 510 WP_104979320.1 DUF4145 domain-containing protein -
O6P42_RS07710 (O6P42_07710) 1505381..1505743 + 363 WP_147289565.1 hypothetical protein -
O6P42_RS07715 (O6P42_07715) 1505893..1506441 + 549 WP_104979317.1 hypothetical protein -
O6P42_RS07720 (O6P42_07720) 1506586..1507122 + 537 WP_104975413.1 nucleotidyltransferase family protein -
O6P42_RS07725 (O6P42_07725) 1507259..1507537 - 279 WP_005398411.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
O6P42_RS07730 (O6P42_07730) 1507534..1507818 - 285 WP_005398409.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
O6P42_RS07735 (O6P42_07735) 1507895..1507987 + 93 WP_104975412.1 DUF3265 domain-containing protein -
O6P42_RS07740 (O6P42_07740) 1508139..1508555 + 417 WP_104979313.1 hypothetical protein -
O6P42_RS07745 (O6P42_07745) 1508552..1508938 + 387 WP_104979311.1 hypothetical protein -
O6P42_RS07750 (O6P42_07750) 1508966..1509031 + 66 Protein_1449 DUF3265 domain-containing protein -
O6P42_RS07755 (O6P42_07755) 1509112..1510071 + 960 WP_104975411.1 phosphotransferase -
O6P42_RS07760 (O6P42_07760) 1510188..1510586 + 399 WP_042524338.1 SMI1/KNR4 family protein -
O6P42_RS07765 (O6P42_07765) 1510733..1511023 + 291 WP_042523463.1 hypothetical protein -
O6P42_RS07770 (O6P42_07770) 1511247..1511627 + 381 WP_104979310.1 STAS/SEC14 domain-containing protein -
O6P42_RS07775 (O6P42_07775) 1512211..1512300 + 90 WP_077345960.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - vxsC / exsA / exsD / vscB / vscC / vscD / vscF / vscG / vscI / vscJ / vscK / vscL / vopS / vopR / vecA / vopQ / vscU / vscT / vscS / vscR / vscQ / vscO / vscN / vopN / tyeA/vcr1 / sycN/vcr2 / vscX / vscY / vcrD / vcrR / vcrG / vcrV / vcrH / vopB / vopD / VP1611 1227030..1747664 520634
- inside Integron - - 1473288..1538216 64928


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-69)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10891.57 Da        Isoelectric Point: 4.3430

>T273588 WP_005398411.1 NZ_CP118930:c1507537-1507259 [Vibrio alginolyticus]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11069.40 Da        Isoelectric Point: 9.2167

>AT273588 WP_005398409.1 NZ_CP118930:c1507818-1507534 [Vibrio alginolyticus]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR22

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR21

References