Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 1366816..1367363 Replicon chromosome
Accession NZ_CP118930
Organism Vibrio alginolyticus strain V208

Toxin (Protein)


Gene name relE Uniprot ID A0A4P8FYK5
Locus tag O6P42_RS06795 Protein ID WP_005377013.1
Coordinates 1367061..1367363 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A4P8G149
Locus tag O6P42_RS06790 Protein ID WP_005377012.1
Coordinates 1366816..1367073 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O6P42_RS06725 (O6P42_06725) 1362043..1362132 + 90 WP_072828858.1 DUF3265 domain-containing protein -
O6P42_RS06730 (O6P42_06730) 1362159..1362527 + 369 WP_104979383.1 hypothetical protein -
O6P42_RS06735 (O6P42_06735) 1362545..1362634 + 90 WP_072828858.1 DUF3265 domain-containing protein -
O6P42_RS06740 (O6P42_06740) 1362671..1363168 + 498 WP_069536324.1 DNA topology modulation protein -
O6P42_RS06745 (O6P42_06745) 1363153..1363275 + 123 WP_239915439.1 DUF3265 domain-containing protein -
O6P42_RS06750 (O6P42_06750) 1363306..1364046 + 741 WP_115386090.1 hypothetical protein -
O6P42_RS06755 (O6P42_06755) 1364152..1364640 + 489 WP_054730813.1 hypothetical protein -
O6P42_RS06760 (O6P42_06760) 1364665..1364754 + 90 WP_072609598.1 DUF3265 domain-containing protein -
O6P42_RS06765 (O6P42_06765) 1364796..1365206 + 411 WP_021033956.1 cytidine deaminase -
O6P42_RS06770 (O6P42_06770) 1365221..1365313 + 93 WP_079764222.1 DUF3265 domain-containing protein -
O6P42_RS06775 (O6P42_06775) 1365346..1365888 + 543 WP_170897297.1 GNAT family N-acetyltransferase -
O6P42_RS06780 (O6P42_06780) 1365885..1365950 + 66 Protein_1255 DUF3265 domain-containing protein -
O6P42_RS06785 (O6P42_06785) 1366021..1366626 + 606 WP_238939371.1 DUF922 domain-containing protein -
O6P42_RS06790 (O6P42_06790) 1366816..1367073 + 258 WP_005377012.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
O6P42_RS06795 (O6P42_06795) 1367061..1367363 + 303 WP_005377013.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O6P42_RS06800 (O6P42_06800) 1367399..1367491 + 93 WP_115386088.1 DUF3265 domain-containing protein -
O6P42_RS06805 (O6P42_06805) 1367520..1368161 + 642 WP_115386087.1 hypothetical protein -
O6P42_RS06810 (O6P42_06810) 1368119..1368274 + 156 WP_238844095.1 DUF3265 domain-containing protein -
O6P42_RS06815 (O6P42_06815) 1368410..1368763 + 354 WP_147289569.1 hypothetical protein -
O6P42_RS06820 (O6P42_06820) 1368789..1368878 + 90 WP_115386423.1 DUF3265 domain-containing protein -
O6P42_RS06825 (O6P42_06825) 1368918..1369379 + 462 WP_025796455.1 GIY-YIG nuclease family protein -
O6P42_RS06830 (O6P42_06830) 1369494..1369814 + 321 WP_053300079.1 hypothetical protein -
O6P42_RS06835 (O6P42_06835) 1370369..1370458 + 90 WP_115386422.1 DUF3265 domain-containing protein -
O6P42_RS06840 (O6P42_06840) 1370492..1370887 + 396 WP_115386085.1 DUF3465 domain-containing protein -
O6P42_RS06845 (O6P42_06845) 1371427..1371555 + 129 WP_099098883.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - vxsC / exsA / exsD / vscB / vscC / vscD / vscF / vscG / vscI / vscJ / vscK / vscL / vopS / vopR / vecA / vopQ / vscU / vscT / vscS / vscR / vscQ / vscO / vscN / vopN / tyeA/vcr1 / sycN/vcr2 / vscX / vscY / vcrD / vcrR / vcrG / vcrV / vcrH / vopB / vopD / VP1611 1227030..1747664 520634
- inside Integron - - 1302814..1384001 81187


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11651.54 Da        Isoelectric Point: 5.1765

>T273587 WP_005377013.1 NZ_CP118930:1367061-1367363 [Vibrio alginolyticus]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVIRAERDLRKFLLSKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9620.12 Da        Isoelectric Point: 6.7269

>AT273587 WP_005377012.1 NZ_CP118930:1366816-1367073 [Vibrio alginolyticus]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVISHDEAKDKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P8FYK5

Antitoxin

Source ID Structure
AlphaFold DB A0A4P8G149

References