Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 1323254..1323801 | Replicon | chromosome |
| Accession | NZ_CP118930 | ||
| Organism | Vibrio alginolyticus strain V208 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A3RE16 |
| Locus tag | O6P42_RS06310 | Protein ID | WP_017420363.1 |
| Coordinates | 1323499..1323801 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A3RE15 |
| Locus tag | O6P42_RS06305 | Protein ID | WP_017420364.1 |
| Coordinates | 1323254..1323511 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6P42_RS06235 (O6P42_06235) | 1318468..1318557 | + | 90 | WP_081008380.1 | DUF3265 domain-containing protein | - |
| O6P42_RS06240 (O6P42_06240) | 1318595..1318885 | + | 291 | WP_042523463.1 | hypothetical protein | - |
| O6P42_RS06245 (O6P42_06245) | 1319026..1319571 | + | 546 | WP_171346386.1 | hypothetical protein | - |
| O6P42_RS06250 (O6P42_06250) | 1319586..1319678 | + | 93 | WP_140065282.1 | DUF3265 domain-containing protein | - |
| O6P42_RS06255 (O6P42_06255) | 1319705..1320412 | + | 708 | WP_170960366.1 | CBS domain-containing protein | - |
| O6P42_RS06260 (O6P42_06260) | 1320435..1320527 | + | 93 | WP_115386060.1 | DUF3265 domain-containing protein | - |
| O6P42_RS06265 (O6P42_06265) | 1320546..1320836 | - | 291 | WP_005377002.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| O6P42_RS06270 (O6P42_06270) | 1320826..1321074 | - | 249 | WP_115386113.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| O6P42_RS06275 (O6P42_06275) | 1321131..1321217 | + | 87 | WP_225492314.1 | DUF3265 domain-containing protein | - |
| O6P42_RS06280 (O6P42_06280) | 1321274..1321792 | + | 519 | WP_115386431.1 | AAA family ATPase | - |
| O6P42_RS06285 (O6P42_06285) | 1321773..1321898 | + | 126 | WP_180797120.1 | DUF3265 domain-containing protein | - |
| O6P42_RS06290 (O6P42_06290) | 1321929..1322453 | + | 525 | WP_203488919.1 | hypothetical protein | - |
| O6P42_RS06295 (O6P42_06295) | 1322450..1322560 | + | 111 | WP_231583863.1 | DUF3265 domain-containing protein | - |
| O6P42_RS06300 (O6P42_06300) | 1322708..1323064 | + | 357 | Protein_1159 | GNAT family N-acetyltransferase | - |
| O6P42_RS06305 (O6P42_06305) | 1323254..1323511 | + | 258 | WP_017420364.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| O6P42_RS06310 (O6P42_06310) | 1323499..1323801 | + | 303 | WP_017420363.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O6P42_RS06315 (O6P42_06315) | 1323837..1323929 | + | 93 | WP_130350890.1 | DUF3265 domain-containing protein | - |
| O6P42_RS06320 (O6P42_06320) | 1324091..1324312 | + | 222 | WP_004400149.1 | VF530 family protein | - |
| O6P42_RS06325 (O6P42_06325) | 1324446..1325594 | + | 1149 | WP_275115142.1 | hypothetical protein | - |
| O6P42_RS06330 (O6P42_06330) | 1325745..1326098 | + | 354 | WP_041061919.1 | glyoxalase/bleomycin resistance/dioxygenase family protein | - |
| O6P42_RS06335 (O6P42_06335) | 1326116..1326205 | + | 90 | WP_072875472.1 | DUF3265 domain-containing protein | - |
| O6P42_RS06340 (O6P42_06340) | 1326233..1326583 | + | 351 | WP_031781288.1 | hypothetical protein | - |
| O6P42_RS06345 (O6P42_06345) | 1326610..1326702 | + | 93 | WP_171345234.1 | DUF3265 domain-containing protein | - |
| O6P42_RS06350 (O6P42_06350) | 1326744..1327508 | + | 765 | WP_275115143.1 | hypothetical protein | - |
| O6P42_RS06355 (O6P42_06355) | 1327534..1327626 | + | 93 | WP_275115144.1 | DUF3265 domain-containing protein | - |
| O6P42_RS06360 (O6P42_06360) | 1327662..1328204 | + | 543 | WP_076665239.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | vxsC / exsA / exsD / vscB / vscC / vscD / vscF / vscG / vscI / vscJ / vscK / vscL / vopS / vopR / vecA / vopQ / vscU / vscT / vscS / vscR / vscQ / vscO / vscN / vopN / tyeA/vcr1 / sycN/vcr2 / vscX / vscY / vcrD / vcrR / vcrG / vcrV / vcrH / vopB / vopD / VP1611 | 1227030..1747664 | 520634 | |
| - | inside | Integron | - | - | 1302814..1384001 | 81187 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11611.53 Da Isoelectric Point: 5.8692
>T273586 WP_017420363.1 NZ_CP118930:1323499-1323801 [Vibrio alginolyticus]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGGKV
FILFVMRAERDLRKFLLSKQ
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGGKV
FILFVMRAERDLRKFLLSKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|