Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 3705500..3706206 | Replicon | chromosome |
| Accession | NZ_CP118927 | ||
| Organism | Citrobacter koseri strain L2395 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | PX343_RS17720 | Protein ID | WP_121265183.1 |
| Coordinates | 3705500..3705868 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | PX343_RS17725 | Protein ID | WP_275055238.1 |
| Coordinates | 3705889..3706206 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PX343_RS17700 (PX343_17700) | 3701232..3701714 | + | 483 | WP_012133757.1 | L-2-amino-thiazoline-4-carboxylic acid hydrolase | - |
| PX343_RS17705 (PX343_17705) | 3701711..3702934 | + | 1224 | WP_275055236.1 | Zn-dependent hydrolase | - |
| PX343_RS17710 (PX343_17710) | 3703204..3704187 | + | 984 | WP_275055237.1 | DUF1852 domain-containing protein | - |
| PX343_RS17715 (PX343_17715) | 3704215..3705246 | + | 1032 | WP_115615052.1 | methionine synthase | - |
| PX343_RS17720 (PX343_17720) | 3705500..3705868 | - | 369 | WP_121265183.1 | TA system toxin CbtA family protein | Toxin |
| PX343_RS17725 (PX343_17725) | 3705889..3706206 | - | 318 | WP_275055238.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PX343_RS17730 (PX343_17730) | 3706225..3706446 | - | 222 | WP_023233115.1 | DUF987 domain-containing protein | - |
| PX343_RS17735 (PX343_17735) | 3706455..3706931 | - | 477 | WP_114263041.1 | RadC family protein | - |
| PX343_RS17740 (PX343_17740) | 3706947..3707411 | - | 465 | WP_121265179.1 | antirestriction protein | - |
| PX343_RS17745 (PX343_17745) | 3707553..3710396 | - | 2844 | WP_275055239.1 | Ag43/Cah family autotransporter adhesin | - |
| PX343_RS17750 (PX343_17750) | 3710469..3711155 | - | 687 | WP_275055240.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3704215..3731451 | 27236 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13743.06 Da Isoelectric Point: 9.1662
>T273579 WP_121265183.1 NZ_CP118927:c3705868-3705500 [Citrobacter koseri]
MKKLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSQIQAPYLTTTDILQARKACGLMSRCSYREVSNIVLSRSRL
MKKLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSQIQAPYLTTTDILQARKACGLMSRCSYREVSNIVLSRSRL
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|