Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3476634..3477254 | Replicon | chromosome |
Accession | NZ_CP118927 | ||
Organism | Citrobacter koseri strain L2395 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | PX343_RS16615 | Protein ID | WP_002892050.1 |
Coordinates | 3477036..3477254 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A8AJY4 |
Locus tag | PX343_RS16610 | Protein ID | WP_012133514.1 |
Coordinates | 3476634..3477008 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PX343_RS16600 (PX343_16600) | 3471770..3472963 | + | 1194 | WP_012133512.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PX343_RS16605 (PX343_16605) | 3472986..3476132 | + | 3147 | WP_012133513.1 | efflux RND transporter permease AcrB | - |
PX343_RS16610 (PX343_16610) | 3476634..3477008 | + | 375 | WP_012133514.1 | Hha toxicity modulator TomB | Antitoxin |
PX343_RS16615 (PX343_16615) | 3477036..3477254 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
PX343_RS16620 (PX343_16620) | 3477438..3477989 | + | 552 | WP_047458424.1 | maltose O-acetyltransferase | - |
PX343_RS16625 (PX343_16625) | 3478103..3478573 | + | 471 | WP_060815856.1 | YlaC family protein | - |
PX343_RS16630 (PX343_16630) | 3478651..3478791 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
PX343_RS16635 (PX343_16635) | 3478793..3479053 | - | 261 | WP_012133519.1 | type B 50S ribosomal protein L31 | - |
PX343_RS16640 (PX343_16640) | 3479279..3480829 | + | 1551 | WP_275055202.1 | EAL domain-containing protein | - |
PX343_RS16645 (PX343_16645) | 3480869..3481222 | - | 354 | WP_012133521.1 | DUF1428 family protein | - |
PX343_RS16650 (PX343_16650) | 3481302..3481916 | - | 615 | WP_112002130.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3476634..3484678 | 8044 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T273578 WP_002892050.1 NZ_CP118927:3477036-3477254 [Citrobacter koseri]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14437.27 Da Isoelectric Point: 5.1444
>AT273578 WP_012133514.1 NZ_CP118927:3476634-3477008 [Citrobacter koseri]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A8AJY4 |