Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2446713..2447352 | Replicon | chromosome |
| Accession | NZ_CP118927 | ||
| Organism | Citrobacter koseri strain L2395 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A381H3Z1 |
| Locus tag | PX343_RS11770 | Protein ID | WP_071818852.1 |
| Coordinates | 2446713..2446889 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PX343_RS11775 | Protein ID | WP_125337124.1 |
| Coordinates | 2446936..2447352 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PX343_RS11750 (PX343_11750) | 2441806..2442681 | + | 876 | WP_012132344.1 | AraC family transcriptional regulator | - |
| PX343_RS11755 (PX343_11755) | 2442658..2443824 | - | 1167 | WP_275055024.1 | benzoate/H(+) symporter BenE family transporter | - |
| PX343_RS11760 (PX343_11760) | 2443917..2444453 | + | 537 | WP_058669186.1 | XRE family transcriptional regulator | - |
| PX343_RS11765 (PX343_11765) | 2444532..2446493 | + | 1962 | WP_275055025.1 | U32 family peptidase | - |
| PX343_RS11770 (PX343_11770) | 2446713..2446889 | + | 177 | WP_071818852.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PX343_RS11775 (PX343_11775) | 2446936..2447352 | + | 417 | WP_125337124.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PX343_RS11780 (PX343_11780) | 2447403..2448812 | + | 1410 | WP_275055026.1 | PLP-dependent aminotransferase family protein | - |
| PX343_RS11785 (PX343_11785) | 2449132..2450556 | + | 1425 | WP_012132353.1 | aminobutyraldehyde dehydrogenase | - |
| PX343_RS11790 (PX343_11790) | 2450655..2450750 | - | 96 | WP_071818853.1 | stress response membrane protein YncL | - |
| PX343_RS11795 (PX343_11795) | 2450942..2451115 | + | 174 | WP_049008504.1 | GhoT/OrtT family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.81 Da Isoelectric Point: 10.8122
>T273577 WP_071818852.1 NZ_CP118927:2446713-2446889 [Citrobacter koseri]
VKQSEFRRWLESQGVDVTNGTNHLKLRYHDKRSVMPRHPGDEIKDTLRKAILKQLGLN
VKQSEFRRWLESQGVDVTNGTNHLKLRYHDKRSVMPRHPGDEIKDTLRKAILKQLGLN
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15370.62 Da Isoelectric Point: 4.4377
>AT273577 WP_125337124.1 NZ_CP118927:2446936-2447352 [Citrobacter koseri]
MRYPVNLIPAEEGGYVVSFPDIPEALTQGDTRHESLEAAQGALVTAFEFYFEDNQPIPLPSMVDEADDYVEIPLSIASKV
LLLNAFLESKITQQELARRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSLTML
MRYPVNLIPAEEGGYVVSFPDIPEALTQGDTRHESLEAAQGALVTAFEFYFEDNQPIPLPSMVDEADDYVEIPLSIASKV
LLLNAFLESKITQQELARRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSLTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|