Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 330348..330934 | Replicon | chromosome |
| Accession | NZ_CP118927 | ||
| Organism | Citrobacter koseri strain L2395 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | PX343_RS01510 | Protein ID | WP_047460595.1 |
| Coordinates | 330566..330934 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | PX343_RS01505 | Protein ID | WP_047460592.1 |
| Coordinates | 330348..330569 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PX343_RS01485 (PX343_01485) | 326514..327440 | + | 927 | WP_012135564.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| PX343_RS01490 (PX343_01490) | 327437..328714 | + | 1278 | WP_012135563.1 | branched chain amino acid ABC transporter permease LivM | - |
| PX343_RS01495 (PX343_01495) | 328711..329478 | + | 768 | WP_110493706.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| PX343_RS01500 (PX343_01500) | 329496..330209 | + | 714 | WP_047463875.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| PX343_RS01505 (PX343_01505) | 330348..330569 | + | 222 | WP_047460592.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PX343_RS01510 (PX343_01510) | 330566..330934 | + | 369 | WP_047460595.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PX343_RS01515 (PX343_01515) | 331135..332451 | + | 1317 | WP_275055465.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| PX343_RS01520 (PX343_01520) | 332552..333439 | + | 888 | WP_024131024.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| PX343_RS01525 (PX343_01525) | 333436..334281 | + | 846 | WP_012135557.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| PX343_RS01530 (PX343_01530) | 334290..335360 | + | 1071 | WP_049009227.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 327437..336106 | 8669 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13830.14 Da Isoelectric Point: 7.3169
>T273571 WP_047460595.1 NZ_CP118927:330566-330934 [Citrobacter koseri]
MTLQFISAEEIIRFHDKLLSVTPGVPGMPDPGRAEALLYRVLNKYEYESITDVWILAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIFLAANPDYVDMTVEAAAGRLSLEEIVQRLRR
MTLQFISAEEIIRFHDKLLSVTPGVPGMPDPGRAEALLYRVLNKYEYESITDVWILAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIFLAANPDYVDMTVEAAAGRLSLEEIVQRLRR
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|