Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 127126..127708 | Replicon | plasmid pMchErm55 |
Accession | NZ_CP118918 | ||
Organism | Mycobacteroides chelonae strain MCHL-2035 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PXJ67_RS00620 | Protein ID | WP_079632919.1 |
Coordinates | 127349..127708 (+) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A0M2K7R4 |
Locus tag | PXJ67_RS00615 | Protein ID | WP_046361779.1 |
Coordinates | 127126..127362 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXJ67_RS00590 (PXJ67_00590) | 122402..123052 | - | 651 | WP_064282769.1 | cutinase family protein | - |
PXJ67_RS00595 (PXJ67_00595) | 123406..124716 | - | 1311 | WP_064282753.1 | hypothetical protein | - |
PXJ67_RS00600 (PXJ67_00600) | 124820..125488 | + | 669 | WP_046361780.1 | TetR family transcriptional regulator | - |
PXJ67_RS00605 (PXJ67_00605) | 125505..126368 | - | 864 | WP_079632917.1 | hypothetical protein | - |
PXJ67_RS00610 (PXJ67_00610) | 126365..126616 | - | 252 | WP_079632918.1 | transposase | - |
PXJ67_RS00615 (PXJ67_00615) | 127126..127362 | + | 237 | WP_046361779.1 | hypothetical protein | Antitoxin |
PXJ67_RS00620 (PXJ67_00620) | 127349..127708 | + | 360 | WP_079632919.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PXJ67_RS00625 (PXJ67_00625) | 127622..130084 | - | 2463 | WP_275092586.1 | DEAD/DEAH box helicase | - |
PXJ67_RS00630 (PXJ67_00630) | 130484..130969 | + | 486 | WP_048424531.1 | TIR domain-containing protein | - |
PXJ67_RS00635 (PXJ67_00635) | 130969..131991 | + | 1023 | WP_082164298.1 | HIT domain-containing protein | - |
PXJ67_RS00640 (PXJ67_00640) | 131967..132113 | - | 147 | WP_275092587.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..137526 | 137526 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 12760.69 Da Isoelectric Point: 9.4900
>T273569 WP_079632919.1 NZ_CP118918:127349-127708 [Mycobacteroides chelonae]
MESTNPRRGELWLVAFGAGRPGEPAKHRPAVIVSADELLTGDPDPTELVVVIPVSSSRTPTSLRPPITPDEGVDTNSVAV
CRAVRGIARGRLLRHLGTLNRPTMSHIEKSVALILGLDR
MESTNPRRGELWLVAFGAGRPGEPAKHRPAVIVSADELLTGDPDPTELVVVIPVSSSRTPTSLRPPITPDEGVDTNSVAV
CRAVRGIARGRLLRHLGTLNRPTMSHIEKSVALILGLDR
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|