Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2435529..2436166 | Replicon | chromosome |
Accession | NZ_CP118911 | ||
Organism | Bacillus velezensis strain XRD006 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | PXG99_RS12205 | Protein ID | WP_003156187.1 |
Coordinates | 2435529..2435879 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | PXG99_RS12210 | Protein ID | WP_003156188.1 |
Coordinates | 2435885..2436166 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXG99_RS12165 (2430569) | 2430569..2431171 | - | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
PXG99_RS12170 (2431171) | 2431171..2431959 | - | 789 | WP_029974100.1 | RNA polymerase sigma factor SigB | - |
PXG99_RS12175 (2431925) | 2431925..2432407 | - | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
PXG99_RS12180 (2432404) | 2432404..2432733 | - | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
PXG99_RS12185 (2432797) | 2432797..2433804 | - | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
PXG99_RS12190 (2433816) | 2433816..2434217 | - | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
PXG99_RS12195 (2434220) | 2434220..2434585 | - | 366 | WP_007609584.1 | RsbT antagonist protein RsbS | - |
PXG99_RS12200 (2434590) | 2434590..2435411 | - | 822 | WP_003156182.1 | STAS domain-containing protein | - |
PXG99_RS12205 (2435529) | 2435529..2435879 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PXG99_RS12210 (2435885) | 2435885..2436166 | - | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
PXG99_RS12215 (2436286) | 2436286..2437455 | - | 1170 | WP_021495079.1 | alanine racemase | - |
PXG99_RS12220 (2437572) | 2437572..2438579 | - | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
PXG99_RS12225 (2438744) | 2438744..2439109 | - | 366 | WP_007609580.1 | holo-ACP synthase | - |
PXG99_RS12230 (2439202) | 2439202..2439801 | + | 600 | WP_029974099.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T273566 WP_003156187.1 NZ_CP118911:c2435879-2435529 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|