Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1586004..1586921 | Replicon | chromosome |
| Accession | NZ_CP118911 | ||
| Organism | Bacillus velezensis strain XRD006 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | I2HQ15 |
| Locus tag | PXG99_RS07545 | Protein ID | WP_007407256.1 |
| Coordinates | 1586004..1586750 (+) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | I2HQ14 |
| Locus tag | PXG99_RS07550 | Protein ID | WP_003154807.1 |
| Coordinates | 1586751..1586921 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXG99_RS07525 (1581398) | 1581398..1582348 | - | 951 | WP_007610844.1 | ring-cleaving dioxygenase | - |
| PXG99_RS07530 (1582670) | 1582670..1583986 | + | 1317 | WP_007610842.1 | amino acid permease | - |
| PXG99_RS07535 (1584272) | 1584272..1584889 | + | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
| PXG99_RS07540 (1584902) | 1584902..1585900 | + | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
| PXG99_RS07545 (1586004) | 1586004..1586750 | + | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| PXG99_RS07550 (1586751) | 1586751..1586921 | + | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
| PXG99_RS07555 (1587018) | 1587018..1587143 | + | 126 | WP_003154809.1 | hypothetical protein | - |
| PXG99_RS07560 (1587178) | 1587178..1588056 | - | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
| PXG99_RS07565 (1588070) | 1588070..1588333 | - | 264 | WP_003154813.1 | phage holin | - |
| PXG99_RS07570 (1588347) | 1588347..1588610 | - | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
| PXG99_RS07575 (1588662) | 1588662..1589423 | - | 762 | WP_029973064.1 | hypothetical protein | - |
| PXG99_RS07580 (1589480) | 1589480..1589677 | - | 198 | WP_007610833.1 | XkdX family protein | - |
| PXG99_RS07585 (1589682) | 1589682..1590107 | - | 426 | WP_029973065.1 | hypothetical protein | - |
| PXG99_RS07590 (1590120) | 1590120..1591709 | - | 1590 | WP_029973066.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T273565 WP_007407256.1 NZ_CP118911:1586004-1586750 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|