Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
| Location | 5413406..5414045 | Replicon | chromosome |
| Accession | NZ_CP118910 | ||
| Organism | Mycobacterium marinum strain 050012 | ||
Toxin (Protein)
| Gene name | novel[antitoxin] | Uniprot ID | - |
| Locus tag | PQR73_RS21965 | Protein ID | WP_012396162.1 |
| Coordinates | 5413406..5413852 (-) | Length | 149 a.a. |
Antitoxin (Protein)
| Gene name | novel[toxin] | Uniprot ID | B2HEJ8 |
| Locus tag | PQR73_RS21970 | Protein ID | WP_011738542.1 |
| Coordinates | 5413857..5414045 (-) | Length | 63 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQR73_RS21940 (PQR73_021940) | 5408581..5410101 | + | 1521 | WP_012396157.1 | carotenoid oxygenase family protein | - |
| PQR73_RS21945 (PQR73_021945) | 5410118..5410591 | + | 474 | WP_012396158.1 | VOC family protein | - |
| PQR73_RS21950 (PQR73_021950) | 5410597..5411031 | - | 435 | WP_012396159.1 | hypothetical protein | - |
| PQR73_RS21955 (PQR73_021955) | 5411102..5411875 | - | 774 | WP_272467829.1 | VOC family protein | - |
| PQR73_RS21960 (PQR73_021960) | 5412296..5413294 | + | 999 | WP_272467828.1 | EspA/EspE family type VII secretion system effector | - |
| PQR73_RS21965 (PQR73_021965) | 5413406..5413852 | - | 447 | WP_012396162.1 | SRPBCC family protein | Toxin |
| PQR73_RS21970 (PQR73_021970) | 5413857..5414045 | - | 189 | WP_011738542.1 | antitoxin | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 149 a.a. Molecular weight: 15851.39 Da Isoelectric Point: 8.6574
>T273564 WP_012396162.1 NZ_CP118910:c5413852-5413406 [Mycobacterium marinum]
MAKLSGSIDVPLSPDEAWMHASDLSRFKEWLTIHRVWRSTLPETLEKGAVVESIVQVKGMHNRIKWTIVRYQPPEGMTLN
GDGVGGVKVKLMAKVAAGEEGSIVSFDVHLGGPALFGPIGMVVAAALRSDINASLRNFVTVFAPSAAG
MAKLSGSIDVPLSPDEAWMHASDLSRFKEWLTIHRVWRSTLPETLEKGAVVESIVQVKGMHNRIKWTIVRYQPPEGMTLN
GDGVGGVKVKLMAKVAAGEEGSIVSFDVHLGGPALFGPIGMVVAAALRSDINASLRNFVTVFAPSAAG
Download Length: 447 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|