Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 210156..211066 Replicon plasmid p-T-hvKP-1
Accession NZ_CP118907
Organism Klebsiella pneumoniae strain T-hvKP

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag PXG78_RS26395 Protein ID WP_004026354.1
Coordinates 210156..210626 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag PXG78_RS26400 Protein ID WP_004026357.1
Coordinates 210623..211066 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXG78_RS26370 (PXG78_26370) 205568..205966 - 399 WP_004212796.1 H-NS family nucleoid-associated regulatory protein -
PXG78_RS26375 (PXG78_26375) 206303..206797 - 495 WP_004212794.1 thermonuclease family protein -
PXG78_RS26380 (PXG78_26380) 206975..207241 + 267 WP_223175074.1 DUF1173 family protein -
PXG78_RS26385 (PXG78_26385) 207232..207924 + 693 WP_011154578.1 DUF1173 family protein -
PXG78_RS26395 (PXG78_26395) 210156..210626 - 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
PXG78_RS26400 (PXG78_26400) 210623..211066 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
PXG78_RS26405 (PXG78_26405) 211167..211670 - 504 Protein_229 DUF4113 domain-containing protein -
PXG78_RS26410 (PXG78_26410) 211768..211989 - 222 WP_004213643.1 DUF2188 domain-containing protein -
PXG78_RS26415 (PXG78_26415) 212164..212289 - 126 Protein_231 Fe3+-citrate ABC transporter substrate-binding protein -
PXG78_RS26420 (PXG78_26420) 212364..214490 - 2127 WP_004213640.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
PXG78_RS26425 (PXG78_26425) 214577..215530 - 954 Protein_233 fec operon regulator FecR -
PXG78_RS26430 (PXG78_26430) 215527..216048 - 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 / iroB / iroC 1..224153 224153
- flank IS/Tn - - 209310..209813 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T273563 WP_004026354.1 NZ_CP118907:c210626-210156 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT273563 WP_004026357.1 NZ_CP118907:c211066-210623 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References