Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 38671..39341 Replicon plasmid p-T-hvKP-1
Accession NZ_CP118907
Organism Klebsiella pneumoniae strain T-hvKP

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag PXG78_RS25485 Protein ID WP_004213072.1
Coordinates 38671..39114 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag PXG78_RS25490 Protein ID WP_004213073.1
Coordinates 39111..39341 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXG78_RS25450 (PXG78_25450) 34082..34357 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
PXG78_RS25455 (PXG78_25455) 34420..34911 + 492 WP_011251327.1 DM13 domain-containing protein -
PXG78_RS25460 (PXG78_25460) 34960..35880 + 921 WP_004213934.1 DUF1471 domain-containing protein -
PXG78_RS25465 (PXG78_25465) 35971..36374 + 404 Protein_41 GAF domain-containing protein -
PXG78_RS25470 (PXG78_25470) 36892..37527 - 636 Protein_42 mucoid phenotype regulator RmpA2 -
PXG78_RS25475 (PXG78_25475) 37944..38248 + 305 Protein_43 transposase -
PXG78_RS25480 (PXG78_25480) 38271..38522 - 252 WP_186987481.1 hypothetical protein -
PXG78_RS25485 (PXG78_25485) 38671..39114 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
PXG78_RS25490 (PXG78_25490) 39111..39341 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PXG78_RS25495 (PXG78_25495) 39949..41082 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
PXG78_RS25500 (PXG78_25500) 41098..41391 + 294 WP_004213076.1 hypothetical protein -
PXG78_RS25505 (PXG78_25505) 41381..41587 - 207 WP_004213077.1 hypothetical protein -
PXG78_RS25510 (PXG78_25510) 41939..42229 + 291 WP_004213078.1 hypothetical protein -
PXG78_RS25515 (PXG78_25515) 42219..43118 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 / iroB / iroC 1..224153 224153


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T273561 WP_004213072.1 NZ_CP118907:c39114-38671 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT273561 WP_004213073.1 NZ_CP118907:c39341-39111 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References