Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5170784..5171409 | Replicon | chromosome |
| Accession | NZ_CP118906 | ||
| Organism | Klebsiella pneumoniae strain T-hvKP | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A330XB05 |
| Locus tag | PXG78_RS24895 | Protein ID | WP_012737091.1 |
| Coordinates | 5170784..5171167 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | PXG78_RS24900 | Protein ID | WP_004150355.1 |
| Coordinates | 5171167..5171409 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXG78_RS24880 (5168150) | 5168150..5169052 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| PXG78_RS24885 (5169049) | 5169049..5169684 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PXG78_RS24890 (5169681) | 5169681..5170610 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| PXG78_RS24895 (5170784) | 5170784..5171167 | - | 384 | WP_012737091.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PXG78_RS24900 (5171167) | 5171167..5171409 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| PXG78_RS24905 (5171614) | 5171614..5172531 | + | 918 | WP_012737090.1 | alpha/beta hydrolase | - |
| PXG78_RS24910 (5172545) | 5172545..5173486 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| PXG78_RS24915 (5173531) | 5173531..5173968 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| PXG78_RS24920 (5173965) | 5173965..5174825 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| PXG78_RS24925 (5174819) | 5174819..5175418 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14266.53 Da Isoelectric Point: 7.2771
>T273560 WP_012737091.1 NZ_CP118906:c5171167-5170784 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRCEAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKGFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRCEAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKGFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A330XB05 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |