Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4700930..4701446 | Replicon | chromosome |
Accession | NZ_CP118906 | ||
Organism | Klebsiella pneumoniae strain T-hvKP |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | PXG78_RS22650 | Protein ID | WP_004178374.1 |
Coordinates | 4700930..4701214 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | PXG78_RS22655 | Protein ID | WP_002886901.1 |
Coordinates | 4701204..4701446 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXG78_RS22625 (4696326) | 4696326..4696589 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
PXG78_RS22630 (4696719) | 4696719..4696892 | + | 174 | WP_041169004.1 | hypothetical protein | - |
PXG78_RS22635 (4696895) | 4696895..4697638 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
PXG78_RS22640 (4697995) | 4697995..4700133 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PXG78_RS22645 (4700462) | 4700462..4700926 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PXG78_RS22650 (4700930) | 4700930..4701214 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PXG78_RS22655 (4701204) | 4701204..4701446 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PXG78_RS22660 (4701524) | 4701524..4703434 | - | 1911 | WP_012737231.1 | PRD domain-containing protein | - |
PXG78_RS22665 (4703457) | 4703457..4704611 | - | 1155 | WP_012737230.1 | lactonase family protein | - |
PXG78_RS22670 (4704678) | 4704678..4705418 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T273559 WP_004178374.1 NZ_CP118906:c4701214-4700930 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |