Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3945187..3945806 Replicon chromosome
Accession NZ_CP118906
Organism Klebsiella pneumoniae strain T-hvKP

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag PXG78_RS19095 Protein ID WP_002892050.1
Coordinates 3945588..3945806 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag PXG78_RS19090 Protein ID WP_002892066.1
Coordinates 3945187..3945561 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXG78_RS19080 (3940339) 3940339..3941532 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PXG78_RS19085 (3941555) 3941555..3944701 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
PXG78_RS19090 (3945187) 3945187..3945561 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
PXG78_RS19095 (3945588) 3945588..3945806 + 219 WP_002892050.1 HHA domain-containing protein Toxin
PXG78_RS19100 (3945965) 3945965..3946531 + 567 WP_002892030.1 maltose O-acetyltransferase -
PXG78_RS19105 (3946503) 3946503..3946643 - 141 WP_004147370.1 hypothetical protein -
PXG78_RS19110 (3946664) 3946664..3947134 + 471 WP_002892026.1 YlaC family protein -
PXG78_RS19115 (3947109) 3947109..3948566 - 1458 WP_041937768.1 PLP-dependent aminotransferase family protein -
PXG78_RS19120 (3948667) 3948667..3949365 + 699 WP_002892021.1 GNAT family protein -
PXG78_RS19125 (3949362) 3949362..3949502 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
PXG78_RS19130 (3949502) 3949502..3949765 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T273557 WP_002892050.1 NZ_CP118906:3945588-3945806 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT273557 WP_002892066.1 NZ_CP118906:3945187-3945561 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References