Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 1780996..1781639 Replicon chromosome
Accession NZ_CP118906
Organism Klebsiella pneumoniae strain T-hvKP

Toxin (Protein)


Gene name vagD Uniprot ID A4GZE5
Locus tag PXG78_RS08560 Protein ID WP_015874977.1
Coordinates 1780996..1781412 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A4GZE4
Locus tag PXG78_RS08565 Protein ID WP_015874976.1
Coordinates 1781409..1781639 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXG78_RS08540 (1776399) 1776399..1777514 - 1116 WP_015874980.1 salmochelin biosynthesis C-glycosyltransferase IroB -
PXG78_RS08545 (1777687) 1777687..1777965 - 279 Protein_1672 ISNCY family transposase -
PXG78_RS08550 (1778386) 1778386..1780560 + 2175 WP_015874979.1 siderophore salmochelin receptor IroN -
PXG78_RS08555 (1780715) 1780715..1780960 - 246 WP_032447699.1 hypothetical protein -
PXG78_RS08560 (1780996) 1780996..1781412 - 417 WP_015874977.1 type II toxin-antitoxin system VapC family toxin Toxin
PXG78_RS08565 (1781409) 1781409..1781639 - 231 WP_015874976.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PXG78_RS08570 (1782082) 1782082..1782462 + 381 WP_015874975.1 YrzE family protein -
PXG78_RS08575 (1782650) 1782650..1783620 + 971 Protein_1678 IS21-like element IS100 family transposase -
PXG78_RS08580 (1783647) 1783647..1784373 + 727 Protein_1679 IS21-like element helper ATPase IstB -
PXG78_RS08585 (1784417) 1784417..1784530 - 114 WP_015874970.1 Hha/YmoA family nucleoid-associated regulatory protein -
PXG78_RS08590 (1784773) 1784773..1784982 - 210 WP_032447696.1 TraR/DksA family transcriptional regulator -
PXG78_RS08595 (1784972) 1784972..1785553 - 582 WP_000937857.1 DUF2857 domain-containing protein -
PXG78_RS08600 (1785538) 1785538..1785720 - 183 WP_072001695.1 hypothetical protein -
PXG78_RS08605 (1785742) 1785742..1785927 - 186 WP_000205185.1 AlpA family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - iroD / iroC / iroB / iroN 1742725..1786993 44268


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14945.39 Da        Isoelectric Point: 8.5464

>T273551 WP_015874977.1 NZ_CP118906:c1781412-1780996 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAGLRGDRIVVSAVTYAEMRFGATGPKASPHHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8749.80 Da        Isoelectric Point: 4.3533

>AT273551 WP_015874976.1 NZ_CP118906:c1781639-1781409 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMVEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A4GZE5

Antitoxin

Source ID Structure
AlphaFold DB A4GZE4

References