Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 56211..56736 Replicon plasmid pCRKP-3
Accession NZ_CP118904
Organism Klebsiella pneumoniae strain CRKP

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag PXG74_RS28625 Protein ID WP_013023785.1
Coordinates 56431..56736 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag PXG74_RS28620 Protein ID WP_001568025.1
Coordinates 56211..56429 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXG74_RS28600 (PXG74_28600) 51367..52146 + 780 WP_013023780.1 hypothetical protein -
PXG74_RS28605 (PXG74_28605) 52422..53945 + 1524 WP_017899887.1 hypothetical protein -
PXG74_RS28610 (PXG74_28610) 53979..55106 + 1128 WP_013023782.1 DUF4238 domain-containing protein -
PXG74_RS28615 (PXG74_28615) 55103..55393 + 291 WP_013023783.1 hypothetical protein -
PXG74_RS28620 (PXG74_28620) 56211..56429 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PXG74_RS28625 (PXG74_28625) 56431..56736 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
PXG74_RS28630 (PXG74_28630) 56905..57300 + 396 WP_017899885.1 hypothetical protein -
PXG74_RS28635 (PXG74_28635) 57327..57641 + 315 WP_053389906.1 hypothetical protein -
PXG74_RS28640 (PXG74_28640) 57652..58668 + 1017 WP_017899884.1 hypothetical protein -
PXG74_RS28645 (PXG74_28645) 58866..59660 + 795 WP_004197635.1 site-specific integrase -
PXG74_RS28650 (PXG74_28650) 60124..60426 - 303 WP_004197636.1 hypothetical protein -
PXG74_RS28655 (PXG74_28655) 60423..61049 - 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1C / blaCTX-M-15 / tet(A) / mph(A) / sul1 / qacE / qnrB6 / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr - 1..124316 124316


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T273547 WP_013023785.1 NZ_CP118904:56431-56736 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT273547 WP_001568025.1 NZ_CP118904:56211-56429 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References