Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 11201..11853 | Replicon | plasmid pCRKP-1 |
| Accession | NZ_CP118902 | ||
| Organism | Klebsiella pneumoniae strain CRKP | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A8A2Q2K1 |
| Locus tag | PXG74_RS25980 | Protein ID | WP_017901321.1 |
| Coordinates | 11428..11853 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A853H7M9 |
| Locus tag | PXG74_RS25975 | Protein ID | WP_001261275.1 |
| Coordinates | 11201..11431 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXG74_RS25970 (PXG74_25970) | 8372..10948 | + | 2577 | WP_017901322.1 | nuclease domain-containing protein | - |
| PXG74_RS25975 (PXG74_25975) | 11201..11431 | + | 231 | WP_001261275.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PXG74_RS25980 (PXG74_25980) | 11428..11853 | + | 426 | WP_017901321.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PXG74_RS25985 (PXG74_25985) | 11871..12839 | + | 969 | WP_180944519.1 | IS5 family transposase | - |
| PXG74_RS25990 (PXG74_25990) | 12898..13434 | + | 537 | Protein_13 | integrase core domain-containing protein | - |
| PXG74_RS25995 (PXG74_25995) | 13487..13660 | + | 174 | Protein_14 | nuclease | - |
| PXG74_RS26000 (PXG74_26000) | 13847..15403 | + | 1557 | WP_025999314.1 | sensor domain-containing diguanylate cyclase | - |
| PXG74_RS26005 (PXG74_26005) | 15495..15722 | - | 228 | Protein_16 | IS3 family transposase | - |
| PXG74_RS26010 (PXG74_26010) | 15733..15903 | + | 171 | Protein_17 | LysR family transcriptional regulator | - |
| PXG74_RS26015 (PXG74_26015) | 16028..16144 | - | 117 | Protein_18 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(B) / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / qnrB4 / blaDHA-1 | pla | 1..262673 | 262673 | |
| - | flank | IS/Tn | - | - | 11871..12839 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15412.91 Da Isoelectric Point: 7.1364
>T273544 WP_017901321.1 NZ_CP118902:11428-11853 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8A2Q2K1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A853H7M9 |