Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 11201..11853 Replicon plasmid pCRKP-1
Accession NZ_CP118902
Organism Klebsiella pneumoniae strain CRKP

Toxin (Protein)


Gene name vagD Uniprot ID A0A8A2Q2K1
Locus tag PXG74_RS25980 Protein ID WP_017901321.1
Coordinates 11428..11853 (+) Length 142 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A853H7M9
Locus tag PXG74_RS25975 Protein ID WP_001261275.1
Coordinates 11201..11431 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXG74_RS25970 (PXG74_25970) 8372..10948 + 2577 WP_017901322.1 nuclease domain-containing protein -
PXG74_RS25975 (PXG74_25975) 11201..11431 + 231 WP_001261275.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PXG74_RS25980 (PXG74_25980) 11428..11853 + 426 WP_017901321.1 type II toxin-antitoxin system VapC family toxin Toxin
PXG74_RS25985 (PXG74_25985) 11871..12839 + 969 WP_180944519.1 IS5 family transposase -
PXG74_RS25990 (PXG74_25990) 12898..13434 + 537 Protein_13 integrase core domain-containing protein -
PXG74_RS25995 (PXG74_25995) 13487..13660 + 174 Protein_14 nuclease -
PXG74_RS26000 (PXG74_26000) 13847..15403 + 1557 WP_025999314.1 sensor domain-containing diguanylate cyclase -
PXG74_RS26005 (PXG74_26005) 15495..15722 - 228 Protein_16 IS3 family transposase -
PXG74_RS26010 (PXG74_26010) 15733..15903 + 171 Protein_17 LysR family transcriptional regulator -
PXG74_RS26015 (PXG74_26015) 16028..16144 - 117 Protein_18 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(B) / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / qnrB4 / blaDHA-1 pla 1..262673 262673
- flank IS/Tn - - 11871..12839 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 142 a.a.        Molecular weight: 15412.91 Da        Isoelectric Point: 7.1364

>T273544 WP_017901321.1 NZ_CP118902:11428-11853 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE

Download         Length: 426 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8707.72 Da        Isoelectric Point: 4.3410

>AT273544 WP_001261275.1 NZ_CP118902:11201-11431 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFDP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8A2Q2K1

Antitoxin

Source ID Structure
AlphaFold DB A0A853H7M9

References