Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4789373..4789889 | Replicon | chromosome |
| Accession | NZ_CP118901 | ||
| Organism | Klebsiella pneumoniae strain CRKP | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | PXG74_RS23290 | Protein ID | WP_004178374.1 |
| Coordinates | 4789373..4789657 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | PXG74_RS23295 | Protein ID | WP_002886901.1 |
| Coordinates | 4789647..4789889 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXG74_RS23265 (4784769) | 4784769..4785032 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| PXG74_RS23270 (4785162) | 4785162..4785335 | + | 174 | WP_032103426.1 | hypothetical protein | - |
| PXG74_RS23275 (4785338) | 4785338..4786081 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| PXG74_RS23280 (4786438) | 4786438..4788576 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PXG74_RS23285 (4788905) | 4788905..4789369 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PXG74_RS23290 (4789373) | 4789373..4789657 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PXG74_RS23295 (4789647) | 4789647..4789889 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PXG74_RS23300 (4789967) | 4789967..4791877 | - | 1911 | WP_015959311.1 | PRD domain-containing protein | - |
| PXG74_RS23305 (4791900) | 4791900..4793054 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
| PXG74_RS23310 (4793121) | 4793121..4793861 | - | 741 | WP_015959310.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T273541 WP_004178374.1 NZ_CP118901:c4789657-4789373 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |