Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4049283..4049902 | Replicon | chromosome |
Accession | NZ_CP118901 | ||
Organism | Klebsiella pneumoniae strain CRKP |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | PXG74_RS19835 | Protein ID | WP_002892050.1 |
Coordinates | 4049684..4049902 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | PXG74_RS19830 | Protein ID | WP_002892066.1 |
Coordinates | 4049283..4049657 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXG74_RS19820 (4044435) | 4044435..4045628 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PXG74_RS19825 (4045651) | 4045651..4048797 | + | 3147 | WP_004147373.1 | multidrug efflux RND transporter permease subunit AcrB | - |
PXG74_RS19830 (4049283) | 4049283..4049657 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
PXG74_RS19835 (4049684) | 4049684..4049902 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
PXG74_RS19840 (4050061) | 4050061..4050627 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
PXG74_RS19845 (4050599) | 4050599..4050739 | - | 141 | WP_004147370.1 | hypothetical protein | - |
PXG74_RS19850 (4050760) | 4050760..4051230 | + | 471 | WP_002892026.1 | YlaC family protein | - |
PXG74_RS19855 (4051205) | 4051205..4052656 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
PXG74_RS19860 (4052757) | 4052757..4053455 | + | 699 | WP_032434109.1 | GNAT family protein | - |
PXG74_RS19865 (4053452) | 4053452..4053592 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
PXG74_RS19870 (4053592) | 4053592..4053855 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T273539 WP_002892050.1 NZ_CP118901:4049684-4049902 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT273539 WP_002892066.1 NZ_CP118901:4049283-4049657 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |