Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 42648..43444 | Replicon | plasmid p12100-PER |
Accession | NZ_CP118865 | ||
Organism | Providencia rettgeri strain 12100 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A8I2DCD2 |
Locus tag | NTP66_RS20630 | Protein ID | WP_042847109.1 |
Coordinates | 42932..43444 (+) | Length | 171 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A8I2DCF1 |
Locus tag | NTP66_RS20625 | Protein ID | WP_042847112.1 |
Coordinates | 42648..42935 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NTP66_RS20600 | 37906..38394 | + | 489 | WP_042847123.1 | hypothetical protein | - |
NTP66_RS20605 | 38429..38677 | + | 249 | WP_282561982.1 | hypothetical protein | - |
NTP66_RS20610 | 39294..39926 | + | 633 | WP_052219367.1 | hypothetical protein | - |
NTP66_RS20615 | 40206..41120 | + | 915 | WP_042847118.1 | tetratricopeptide repeat protein | - |
NTP66_RS20620 | 41216..42502 | + | 1287 | WP_042847114.1 | sel1 repeat family protein | - |
NTP66_RS20625 | 42648..42935 | + | 288 | WP_042847112.1 | DUF1778 domain-containing protein | Antitoxin |
NTP66_RS20630 | 42932..43444 | + | 513 | WP_042847109.1 | GNAT family N-acetyltransferase | Toxin |
NTP66_RS20635 | 43532..43813 | + | 282 | WP_042847108.1 | hypothetical protein | - |
NTP66_RS20640 | 43854..44243 | + | 390 | WP_042847106.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | ant(3'')-Ia / qacE / sul1 / blaPER-1 / mph(A) / rmtB2 | - | 1..315510 | 315510 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 171 a.a. Molecular weight: 18357.30 Da Isoelectric Point: 9.5976
>T273522 WP_042847109.1 NZ_CP118865:42932-43444 [Providencia rettgeri]
MTLKLTAPEPLKTGHLLEGFSSGEEALDLWLKNRAMSNQNSGASRTFVTTSDNQVMGYYALSSGIVSTNQAVGRFRRNMP
SDIPVILLGRLAVDTRAKGLGVGRGLVKDACHRVIQASGLVGIRGIVVHALTDDAKRFYEHIGFVPSPLDPMMLMITLAD
LQLAMGIHPN
MTLKLTAPEPLKTGHLLEGFSSGEEALDLWLKNRAMSNQNSGASRTFVTTSDNQVMGYYALSSGIVSTNQAVGRFRRNMP
SDIPVILLGRLAVDTRAKGLGVGRGLVKDACHRVIQASGLVGIRGIVVHALTDDAKRFYEHIGFVPSPLDPMMLMITLAD
LQLAMGIHPN
Download Length: 513 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|