Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 68257..68834 | Replicon | plasmid p12100-NDM |
| Accession | NZ_CP118864 | ||
| Organism | Providencia rettgeri strain 12100 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NTP66_RS20110 | Protein ID | WP_048607647.1 |
| Coordinates | 68502..68834 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | U5N340 |
| Locus tag | NTP66_RS20105 | Protein ID | WP_023159984.1 |
| Coordinates | 68257..68502 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTP66_RS20070 | 63959..64303 | + | 345 | WP_023159966.1 | single-stranded DNA-binding protein | - |
| NTP66_RS20075 | 64296..64718 | + | 423 | WP_147675444.1 | hypothetical protein | - |
| NTP66_RS20080 | 64728..65120 | + | 393 | WP_147675443.1 | hypothetical protein | - |
| NTP66_RS20085 | 65157..66227 | + | 1071 | WP_172688831.1 | hypothetical protein | - |
| NTP66_RS20090 | 66584..66952 | + | 369 | WP_172688830.1 | hypothetical protein | - |
| NTP66_RS20095 | 67050..67277 | - | 228 | WP_048607652.1 | plasmid partition protein ParG | - |
| NTP66_RS20100 | 67368..67991 | - | 624 | WP_147675501.1 | ParA family protein | - |
| NTP66_RS20105 | 68257..68502 | + | 246 | WP_023159984.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NTP66_RS20110 | 68502..68834 | + | 333 | WP_048607647.1 | endoribonuclease MazF | Toxin |
| NTP66_RS20115 | 68869..69249 | + | 381 | WP_147675500.1 | hypothetical protein | - |
| NTP66_RS20120 | 69336..69479 | - | 144 | WP_071547955.1 | Hok/Gef family protein | - |
| NTP66_RS20125 | 69844..70641 | - | 798 | WP_147675499.1 | hypothetical protein | - |
| NTP66_RS20130 | 71044..71997 | + | 954 | WP_048821757.1 | site-specific integrase | - |
| NTP66_RS20135 | 72013..72828 | + | 816 | WP_071547989.1 | DUF4365 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | rmtB2 / blaNDM-1 | - | 1..118246 | 118246 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12081.82 Da Isoelectric Point: 7.1057
>T273521 WP_048607647.1 NZ_CP118864:68502-68834 [Providencia rettgeri]
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTSV
DWRARKVTKKGKVEASELAEIKAKAKALIG
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTSV
DWRARKVTKKGKVEASELAEIKAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|