Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/COG3657-dnstrm_HI1420 |
| Location | 4213961..4214544 | Replicon | chromosome |
| Accession | NZ_CP118863 | ||
| Organism | Providencia rettgeri strain 12100 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | NTP66_RS19050 | Protein ID | WP_140172875.1 |
| Coordinates | 4214242..4214544 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NTP66_RS19045 | Protein ID | WP_004265229.1 |
| Coordinates | 4213961..4214245 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTP66_RS19020 | 4209121..4210098 | - | 978 | WP_004265237.1 | 6-phosphofructokinase | - |
| NTP66_RS19025 | 4210505..4211449 | - | 945 | WP_102140623.1 | phosphatidate cytidylyltransferase | - |
| NTP66_RS19030 | 4211446..4212087 | - | 642 | WP_140172874.1 | lysophospholipid acyltransferase family protein | - |
| NTP66_RS19035 | 4212325..4213077 | - | 753 | WP_004907010.1 | M48 family metallopeptidase | - |
| NTP66_RS19040 | 4213297..4213878 | - | 582 | WP_094961882.1 | HutD family protein | - |
| NTP66_RS19045 | 4213961..4214245 | - | 285 | WP_004265229.1 | putative addiction module antidote protein | Antitoxin |
| NTP66_RS19050 | 4214242..4214544 | - | 303 | WP_140172875.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NTP66_RS19055 | 4214852..4215622 | + | 771 | WP_094961881.1 | hypothetical protein | - |
| NTP66_RS19060 | 4215652..4215870 | - | 219 | WP_094961880.1 | ogr/Delta-like zinc finger family protein | - |
| NTP66_RS19065 | 4215942..4217039 | - | 1098 | WP_125893516.1 | phage late control D family protein | - |
| NTP66_RS19070 | 4217036..4217482 | - | 447 | WP_102140831.1 | phage tail protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4213961..4247628 | 33667 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11463.39 Da Isoelectric Point: 9.8470
>T273518 WP_140172875.1 NZ_CP118863:c4214544-4214242 [Providencia rettgeri]
MITVLTTECFDSWIKNLRDIRAKTKILMRIRWLKNGNYGDVQPIGDGFSELRVHEGQGYRVYLKQKNNVIVILLCGGTKA
TQQKDIHKAKLLFGEVEGEL
MITVLTTECFDSWIKNLRDIRAKTKILMRIRWLKNGNYGDVQPIGDGFSELRVHEGQGYRVYLKQKNNVIVILLCGGTKA
TQQKDIHKAKLLFGEVEGEL
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|