Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 3958774..3959359 | Replicon | chromosome |
| Accession | NZ_CP118863 | ||
| Organism | Providencia rettgeri strain 12100 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | D4C3N9 |
| Locus tag | NTP66_RS17770 | Protein ID | WP_004905874.1 |
| Coordinates | 3958774..3959091 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | D4C3P0 |
| Locus tag | NTP66_RS17775 | Protein ID | WP_004905876.1 |
| Coordinates | 3959072..3959359 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTP66_RS17740 | 3954477..3954728 | - | 252 | WP_140171816.1 | DUF1471 domain-containing protein | - |
| NTP66_RS17745 | 3954999..3955337 | + | 339 | WP_140171817.1 | GIY-YIG nuclease family protein | - |
| NTP66_RS17750 | 3955310..3955813 | - | 504 | WP_112308100.1 | N-acetyltransferase | - |
| NTP66_RS17755 | 3955807..3956331 | - | 525 | WP_140171818.1 | SCP2 domain-containing protein | - |
| NTP66_RS17760 | 3956846..3957841 | + | 996 | WP_140171819.1 | peptidase U32 family protein | - |
| NTP66_RS17765 | 3957859..3958734 | + | 876 | WP_140171820.1 | U32 family peptidase | - |
| NTP66_RS17770 | 3958774..3959091 | - | 318 | WP_004905874.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| NTP66_RS17775 | 3959072..3959359 | - | 288 | WP_004905876.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NTP66_RS17780 | 3959490..3960644 | - | 1155 | WP_140171821.1 | ABC transporter permease | - |
| NTP66_RS17785 | 3960644..3961789 | - | 1146 | WP_004905879.1 | ABC transporter permease | - |
| NTP66_RS17790 | 3961801..3962772 | - | 972 | WP_140171822.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12205.96 Da Isoelectric Point: 9.7799
>T273517 WP_004905874.1 NZ_CP118863:c3959091-3958774 [Providencia rettgeri]
MTQKPSNKRAKQPRQVAYTPTFKKSWERYNRAGRRDMNAAVLVMEILFSQKIIPKEYLDHELEGHEWQGARELHIGGDFL
LVYRLSDKGNLITFVDIGSHSELFG
MTQKPSNKRAKQPRQVAYTPTFKKSWERYNRAGRRDMNAAVLVMEILFSQKIIPKEYLDHELEGHEWQGARELHIGGDFL
LVYRLSDKGNLITFVDIGSHSELFG
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | D4C3N9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A345M0A6 |