Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 2817217..2817752 | Replicon | chromosome |
| Accession | NZ_CP118863 | ||
| Organism | Providencia rettgeri strain 12100 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | NTP66_RS12540 | Protein ID | WP_140170723.1 |
| Coordinates | 2817444..2817752 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | NTP66_RS12535 | Protein ID | WP_140170722.1 |
| Coordinates | 2817217..2817444 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTP66_RS12515 | 2812499..2812939 | + | 441 | WP_110591516.1 | flagellar export chaperone FlgN | - |
| NTP66_RS12520 | 2813126..2813557 | + | 432 | WP_140170720.1 | hypothetical protein | - |
| NTP66_RS12525 | 2813710..2815809 | - | 2100 | WP_004255687.1 | flagellar biosynthesis protein FlhA | - |
| NTP66_RS12530 | 2815802..2816953 | - | 1152 | WP_140170721.1 | flagellar biosynthesis protein FlhB | - |
| NTP66_RS12535 | 2817217..2817444 | + | 228 | WP_140170722.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| NTP66_RS12540 | 2817444..2817752 | + | 309 | WP_140170723.1 | CcdB family protein | Toxin |
| NTP66_RS12545 | 2817768..2818325 | + | 558 | WP_140170724.1 | hypothetical protein | - |
| NTP66_RS12550 | 2818368..2818574 | - | 207 | WP_272661075.1 | helix-turn-helix transcriptional regulator | - |
| NTP66_RS12555 | 2818772..2819410 | - | 639 | WP_094961165.1 | protein phosphatase CheZ | - |
| NTP66_RS12560 | 2819435..2819827 | - | 393 | WP_004255705.1 | chemotaxis response regulator CheY | - |
| NTP66_RS12565 | 2819869..2820936 | - | 1068 | WP_140170725.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
| NTP66_RS12570 | 2820936..2821772 | - | 837 | WP_004255713.1 | chemotaxis protein-glutamate O-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11770.87 Da Isoelectric Point: 8.0469
>T273516 WP_140170723.1 NZ_CP118863:2817444-2817752 [Providencia rettgeri]
MQYRLYQNRDDAIKYPYLLDIQSNIIDLLNTRLVIPLFDSRLVKKPLPARLNPQLVINGQVFILMTHQMACVPHSLLGKE
IVDLSSQRDTIKHAIDLLIDGF
MQYRLYQNRDDAIKYPYLLDIQSNIIDLLNTRLVIPLFDSRLVKKPLPARLNPQLVINGQVFILMTHQMACVPHSLLGKE
IVDLSSQRDTIKHAIDLLIDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|