Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 2332778..2333694 | Replicon | chromosome |
Accession | NZ_CP118863 | ||
Organism | Providencia rettgeri strain 12100 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | NTP66_RS10280 | Protein ID | WP_140172470.1 |
Coordinates | 2333236..2333694 (+) | Length | 153 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | NTP66_RS10275 | Protein ID | WP_140172471.1 |
Coordinates | 2332778..2333239 (+) | Length | 154 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NTP66_RS10245 | 2328445..2329059 | + | 615 | WP_140172475.1 | LysE family translocator | - |
NTP66_RS10250 | 2329083..2329556 | - | 474 | WP_096863737.1 | NUDIX domain-containing protein | - |
NTP66_RS10255 | 2329907..2330548 | - | 642 | WP_140172473.1 | leucine efflux protein LeuE | - |
NTP66_RS10260 | 2331022..2331723 | + | 702 | WP_140172472.1 | AzlC family ABC transporter permease | - |
NTP66_RS10265 | 2331720..2332034 | + | 315 | WP_004254498.1 | AzlD domain-containing protein | - |
NTP66_RS10270 | 2332222..2332689 | + | 468 | WP_036957750.1 | DUF1456 family protein | - |
NTP66_RS10275 | 2332778..2333239 | + | 462 | WP_140172471.1 | DUF2384 domain-containing protein | Antitoxin |
NTP66_RS10280 | 2333236..2333694 | + | 459 | WP_140172470.1 | RES domain-containing protein | Toxin |
NTP66_RS10285 | 2333695..2334585 | - | 891 | WP_094960598.1 | LysR family transcriptional regulator | - |
NTP66_RS10290 | 2334631..2335590 | - | 960 | WP_140172469.1 | acetyl-CoA carboxylase carboxyl transferase subunit alpha | - |
NTP66_RS10295 | 2335696..2336118 | - | 423 | WP_094960600.1 | helix-turn-helix domain-containing protein | - |
NTP66_RS10300 | 2336149..2336676 | - | 528 | WP_282555720.1 | GNAT family N-acetyltransferase | - |
NTP66_RS10305 | 2336693..2338159 | - | 1467 | WP_140172467.1 | AMP nucleosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17159.73 Da Isoelectric Point: 6.4824
>T273515 WP_140172470.1 NZ_CP118863:2333236-2333694 [Providencia rettgeri]
MILYRLVKSNFAHDAWSGQGAMLYGGRWNHKGTPAVYTSTSISLATLEILVHINQDRLLSQFSLLSIDINDKYVMKLSLD
HLPTDWQQDPAPTSTMDIGTIWLNNQDSLALLIPSCIVPYEYNAIINPLHPQFQKVLHTVKPLDFSVDPRLA
MILYRLVKSNFAHDAWSGQGAMLYGGRWNHKGTPAVYTSTSISLATLEILVHINQDRLLSQFSLLSIDINDKYVMKLSLD
HLPTDWQQDPAPTSTMDIGTIWLNNQDSLALLIPSCIVPYEYNAIINPLHPQFQKVLHTVKPLDFSVDPRLA
Download Length: 459 bp
Antitoxin
Download Length: 154 a.a. Molecular weight: 17102.62 Da Isoelectric Point: 9.9140
>AT273515 WP_140172471.1 NZ_CP118863:2332778-2333239 [Providencia rettgeri]
MRNYIPITPLQPTASSFKPLWRHVGLPAERGIELTHFLRQGLSVSVLDNIQEWSGMSKTELLRISGINERNIARRKNAGQ
PLNADESERIARLVRVFDAAVRLFNGDKHAASDWLNHPVKGLGHLRPIELIATESGAIEVIDLIGRIEHGVFS
MRNYIPITPLQPTASSFKPLWRHVGLPAERGIELTHFLRQGLSVSVLDNIQEWSGMSKTELLRISGINERNIARRKNAGQ
PLNADESERIARLVRVFDAAVRLFNGDKHAASDWLNHPVKGLGHLRPIELIATESGAIEVIDLIGRIEHGVFS
Download Length: 462 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|